NESdb

Protein phosphatase 1 regulatory subunit 1B UniProt

Protein phosphatase 1 regulatory subunit 1B

Mus musculus (Mouse)

LMB Sensitive ^{Ref.1A phosphatase cascade by which rewarding stimuli control nucleosomal response., Stipanovich et al., Nature, 2008}

*highlighted yellow in the full sequence

L103A/L109A ^{Ref.1A phosphatase cascade by which rewarding stimuli control nucleosomal response., Stipanovich et al., Nature, 2008}

Unknown

Undetermined

Unknown

Show FASTA Format

>gi|23831273|sp|Q60829.2|PPR1B_MOUSE RecName: Full=Protein phosphatase 1 regulatory subunit 1B; AltName: Full=DARPP-32; AltName: Full=Dopamine- and cAMP-regulated neuronal phosphoprotein
MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRVSEHSSPEEEASPHQRTSGEGHHPKSKRPN
PCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDEDEEEDEEEDSQAEVLKGSRG
TVGQKPTCGRGLEGPWERPPPLDEPQRDGNSEDQVEGRATLSEPGEEPQHPSPP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999987523785249999999799999996089986123103799971235857789888
Pred: CCCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCCCCC
  AA: MDPKDRKKIQFSVPAPPSQLDPRQVEMIRRRRPTPAMLFRVSEHSSPEEEASPHQRTSGE
              10        20        30        40        50        60


Conf: 989999999998668997000011322203666889850344333310599999999998
Pred: CCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCC
  AA: GHHPKSKRPNPCAYTPPSLKAVQHLQTISNLSENQASEEEDELGELRELGYPQEDDEEDE
              70        80        90       100       110       120


Conf: 730000022478873147898898666678889999999999998878999865589889
Pred: CCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: DEEEDEEEDSQAEVLKGSRGTVGQKPTCGRGLEGPWERPPPLDEPQRDGNSEDQVEGRAT
             130       140       150       160       170       180


Conf: 89999999999999
Pred: CCCCCCCCCCCCCC
  AA: LSEPGEEPQHPSPP
             190

Show Conservation Score by AL2CO

1     M       2.390
2     D       1.510
3     P       0.080
4     K       0.274
5     D       0.368
6     R       1.092
7     K       1.431
8     K       2.390
9     I       2.390
10    Q       1.693
11    F       2.390
12    S       0.852
13    V       1.500
14    P       1.169
15    A      -0.004
16    P      -0.062
17    P       0.226
18    S       0.200
19    Q       0.958
20    L       1.624
21    D       1.795
22    P       1.367
23    R       0.152
24    Q       1.031
25    V       0.187
26    E       0.395
27    M       0.682
28    I       2.390
29    R       2.390
30    R       1.430
31    R       2.390
32    R       2.390
33    P       2.390
34    T       2.390
35    P       2.390
36    A       2.390
37    M       0.536
38    L       1.830
39    F       1.487
40    R      -0.031
41    V      -0.227
42    S       0.319
43    E       0.778
44    H      -0.044
45    S      -0.248
46    S       0.473
47    P       0.918
48    E       0.103
49    E      -0.272
50    E       0.066
51    A      -1.210
52    S      -0.931
53    P      -0.837
54    H      -1.313
55    Q      -0.458
56    R      -0.381
57    T      -1.134
58    S      -1.008
59    G      -1.072
60    E      -0.247
61    G      -0.528
62    H      -0.939
63    H      -1.039
64    P      -0.764
65    K      -0.337
66    S      -0.214
67    K      -0.367
68    R       0.200
69    P      -0.892
70    N       0.252
71    P      -0.289
72    C      -0.974
73    A      -0.520
74    Y      -0.055
75    T      -0.622
76    P       0.290
77    P       1.512
78    S       0.170
79    L       0.395
80    K       0.029
81    A       0.155
82    V      -0.630
83    Q       0.117
84    H      -0.870
85    L      -0.455
86    Q      -0.787
87    T      -0.749
88    I      -0.582
89    S      -0.295
90    N      -0.663
91    L      -0.831
92    S      -1.104
93    E      -0.598
94    N      -0.756
95    Q      -1.184
96    A      -1.279
97    S      -0.400
98    E      -1.037
99    E      -0.417
100   E      -0.654
101   D      -0.224
102   E      -0.301
103   L      -0.944
104   G      -0.905
105   E      -0.696
106   L      -1.010
107   R      -0.797
108   E      -0.773
109   L      -0.839
110   G      -0.053
111   Y      -1.192
112   P      -0.756
113   Q      -1.016
114   E      -0.535
115   D      -0.654
116   D      -0.571
117   E      -0.769
118   E      -1.034
119   D      -0.328
120   E      -0.545
121   D      -0.547
122   E      -1.083
123   E      -0.777
124   E      -0.799
125   D      -0.665
126   E      -0.832
127   E      -0.570
128   E      -0.600
129   D      -0.482
130   S      -0.709
131   Q      -0.978
132   A      -0.080
133   E      -0.472
134   V      -0.824
135   L      -0.774
136   K      -0.203
137   G      -1.015
138   S      -1.111
139   R      -0.719
140   G      -0.583
141   T      -1.134
142   V      -0.561
143   G      -0.282
144   Q      -0.151
145   K      -0.363
146   P      -0.576
147   T       0.158
148   C      -0.852
149   G       0.104
150   R      -0.397
151   G       1.218
152   L       0.429
153   E       0.440
154   G      -1.000    *
155   P       0.552
156   W      -0.000
157   E      -0.261
158   R      -0.307
159   P      -1.000    *
160   P       0.230
161   P       0.439
162   L       1.063
163   D      -1.000    *
164   E      -1.000    *
165   P      -1.000    *
166   Q      -1.000    *
167   R      -1.000    *
168   D      -1.000    *
169   G      -1.000    *
170   N      -1.000    *
171   S      -1.000    *
172   E      -1.000    *
173   D      -1.000    *
174   Q      -1.000    *
175   V      -1.000    *
176   E      -1.000    *
177   G      -1.000    *
178   R      -1.000    *
179   A      -1.000    *
180   T      -1.000    *
181   L      -1.000    *
182   S      -1.000    *
183   E      -1.000    *
184   P      -1.000    *
185   G      -1.000    *
186   E      -1.000    *
187   E      -1.000    *
188   P      -1.000    *
189   Q      -1.000    *
190   H      -1.000    *
191   P      -1.000    *
192   S      -1.000    *
193   P      -1.000    *
194   P      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 142.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MDPKDRKKIQ FSVPAPPSQL DPRQVEMIRR RRPTPAMLFR VSEHSSPEEE ASPHQRTSGE 
        70         80         90        100        110        120 
GHHPKSKRPN PCAYTPPSLK AVQHLQTISN LSENQASEEE DELGELRELG YPQEDDEEDE 
       130        140        150        160        170        180 DEEEDEEEDS QAEVLKGSRG TVGQKPTCGR GLEGPWERPP PLDEPQRDGN SEDQVEGRAT 
       190                                                        LSEPGEEPQH PSPP

Not Available

DARPP32 is a prominent mediator of dopmaine signaling in the striatum. Stipanowich et al. showed that when in the nucleus, DARPP32, a potent inhibitor of protein phosphotase-1, can promote the phosphorylation of histone H3. DAPRR32 actively shuttles between the nucleus and the cytoplasm. The export is enhanced by phosphorylation of S97, which can be controlled by dopmain D1 receptor and cAMP.

[1]. "A phosphatase cascade by which rewarding stimuli control nucleosomal response."
Stipanovich A, Valjent E, Matamales M, Nishi A, Ahn JH, Maroteaux M, Bertran-Gonzalez J, Brami-Cherrier K, Enslen H, Corbille AG, Filhol O, Nairn AC, Greengard P, Herve D, Girault JA (2008) Nature, 453:879-84 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©