NESdb

Protein chibby homolog 1 UniProt

PKD2 interactor, Golgi and endoplasmic reticulum-associated 1
PIGEA-14
Cytosolic leucine-rich protein
ARPP-binding protein

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Nuclear-Cytoplasmic Shuttling of Chibby Controls β-Catenin Signaling., Li et al., Mol Biol Cell, 2009}

*highlighted yellow in the full sequence

L21A, L24A, L21A/L24A/L27A ^{Ref.1Nuclear-Cytoplasmic Shuttling of Chibby Controls β-Catenin Signaling., Li et al., Mol Biol Cell, 2009}

Unknown

Undetermined

Unknown

Show FASTA Format

>gi|20454882|sp|Q9Y3M2.1|CBY1_HUMAN RecName: Full=Protein chibby homolog 1; AltName: Full=ARPP-binding protein; AltName: Full=Cytosolic leucine-rich protein; AltName: Full=PIGEA-14; AltName: Full=PKD2 interactor, Golgi and endoplasmic reticulum-associated 1
MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWIAETGVSGGVD
RREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999899989999999742344588889920256560778799600018932474388375
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCEEEEECCEEE
  AA: MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEYGSPTMNLAGQSLKFENGQWI
              10        20        30        40        50        60


Conf: 525789998817889988644455655555677899999987798898763299889999
Pred: ECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
  AA: AETGVSGGVDRREVQRLRRRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELR
              70        80        90       100       110       120


Conf: 951059
Pred: HHHHCC
  AA: ISRKRK

Show Conservation Score by AL2CO

1     M       2.614
2     P       2.099
3     F       1.205
4     F       1.880
5     G      -0.229
6     N       0.211
7     T      -0.100
8     F       1.741
9     S      -0.205
10    P       0.284
11    K       1.571
12    K      -0.317
13    T      -0.682
14    P       1.112
15    P      -0.419
16    R       2.013
17    K       0.160
18    S      -1.158
19    A      -0.188
20    S      -0.100
21    L      -0.083
22    S      -0.127
23    N      -0.034
24    L       0.002
25    H      -1.099
26    S      -1.357
27    L      -0.112
28    D       0.348
29    R      -0.950
30    S      -1.166
31    T      -0.671
32    R      -0.562
33    E      -0.251
34    V      -1.157
35    E       1.072
36    L       0.050
37    G       0.035
38    L      -0.484
39    E      -0.437
40    Y      -0.536
41    G      -0.141
42    S      -1.018
43    P       0.551
44    T      -0.661
45    M       0.254
46    N      -0.281
47    L       2.102
48    A      -0.094
49    G       0.115
50    Q      -0.600
51    S      -0.941
52    L      -0.003
53    K      -0.564
54    F       1.995
55    E      -0.549
56    N      -0.162
57    G       2.736
58    Q      -1.046
59    W       3.255
60    I      -0.694
61    A      -0.602
62    E       0.065
63    T      -0.354
64    G      -1.293
65    V      -1.458
66    S      -0.898
67    G      -0.964
68    G      -0.572
69    V      -1.231
70    D      -1.096
71    R      -1.557
72    R      -0.623
73    E      -0.776
74    V      -1.191
75    Q      -1.205
76    R      -1.176
77    L      -0.385
78    R      -0.208
79    R      -0.577
80    R      -0.603
81    N      -0.784
82    Q      -0.731
83    Q      -0.858
84    L       1.585
85    E      -0.802
86    E       1.102
87    E       1.448
88    N       2.049
89    N       0.924
90    L      -0.245
91    L       1.270
92    R       0.423
93    L      -0.526
94    K       0.753
95    V      -0.517
96    D       0.276
97    I       0.582
98    L       2.022
99    L       0.517
100   D       0.864
101   M       1.256
102   L       0.963
103   S       0.561
104   E       0.115
105   S      -0.156
106   T      -0.200
107   A       0.066
108   E      -0.131
109   S      -0.950
110   H      -0.291
111   L      -0.915
112   M      -0.701
113   E      -0.025
114   K      -0.254
115   E       0.349
116   L       0.258
117   D       0.249
118   E      -1.066
119   L      -1.000    *
120   R      -1.000    *
121   I      -1.000    *
122   S      -1.000    *
123   R      -1.000    *
124   K      -1.000    *
125   R      -1.000    *
126   K      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 151.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MPFFGNTFSP KKTPPRKSAS LSNLHSLDRS TREVELGLEY GSPTMNLAGQ SLKFENGQWI 
        70         80         90        100        110        120 AETGVSGGVD RREVQRLRRR NQQLEEENNL LRLKVDILLD MLSESTAESH LMEKELDELR 
                                                                  ISRKRK

Not Available

Chibby is a highly conserved protein that directly interacts with the C-terminal activation domain of β-catenin. Li et al. showed here that Chibby is a nuclear-cytoplasmic shuttling protein with a classic NLS at 123-126 and one NES at 21-29. The efficient export of Chibby requires protein 14-3-3. Note that amino acids 90-99 resembles NES. But mutations have no effect on export.

[1]. "Nuclear-Cytoplasmic Shuttling of Chibby Controls β-Catenin Signaling."
Li FQ, Mofunanya A, Fischer V, Hall J, Takemaru KI (2009) Mol Biol Cell, : PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©