NESdb

Summary for FGF-1 (NES ID: 170)

Full Name

Fibroblast growth factor-1 UniProt

Alternative Names

Heparin-binding growth factor 1, Acidic fibroblast growth factor,

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1 ^{Ref.1A nuclear export sequence located on a beta-strand in fibroblast growth factor-1., Nilsen et al., J Biol Chem, 2007}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

I145A/L146A/F147A, L148A, L150A/V152A ^{Ref.1A nuclear export sequence located on a beta-strand in fibroblast growth factor-1., Nilsen et al., J Biol Chem, 2007}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

¹³⁸THYGQKAILFLPLPVSSD¹⁵⁵ ^{Ref.1A nuclear export sequence located on a beta-strand in fibroblast growth factor-1., Nilsen et al., J Biol Chem, 2007}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|122737|sp|P05230.1|FGF1_HUMAN RecName: Full=Heparin-binding growth factor 1; Short=HBGF-1; AltName: Full=Acidic fibroblast growth factor; Short=aFGF; AltName: Full=Beta-endothelial cell growth factor; AltName: Full=ECGF-beta; Flags: Precursor
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVY
IKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHY
GQKAILFLPLPVSSD

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988875666676532699999999943776214867689889991640225999930599
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEECCCCCEEEEECCCCCCCEEE
  AA: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
              10        20        30        40        50        60


Conf: 988566279998636352576569981430148999860489864066411100424887
Pred: EEEEEEEEEEEEECCCCCEEEECCCCCEEECCCCCCCCCEEEEEEECCCEEEEECCCCCC
  AA: LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
              70        80        90       100       110       120


Conf: 44999688994447999889984215841258899
Pred: CEEEEECCCCCCCCCCCCCCCCCCEEEECCCCCCC
  AA: NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
             130       140       150

Show Conservation Score by AL2CO

1     M      -1.000    *
2     A      -1.000    *
3     E      -1.000    *
4     G      -1.000    *
5     E      -1.000    *
6     I      -1.000    *
7     T      -1.000    *
8     T      -1.000    *
9     F      -1.000    *
10    T      -1.000    *
11    A      -1.000    *
12    L      -1.000    *
13    T      -1.000    *
14    E      -1.000    *
15    K      -1.000    *
16    F      -1.000    *
17    N      -1.000    *
18    L      -0.646
19    P      -0.898
20    P      -1.060
21    G      -0.245
22    N      -0.501
23    Y      -0.988
24    K      -0.736
25    K      -0.299
26    P      -1.010
27    K      -0.296
28    L       0.274
29    L       0.832
30    Y       0.921
31    C       0.513
32    S      -0.414
33    N      -0.684
34    G       0.015
35    G      -0.452
36    H      -0.652
37    F       0.073
38    L       0.476
39    R      -0.723
40    I       1.059
41    L      -1.010
42    P      -0.697
43    D       0.054
44    G      -0.041
45    T      -0.723
46    V       0.840
47    D      -1.044
48    G       0.139
49    T      -0.784
50    R      -1.314
51    D      -0.993
52    R      -1.016
53    S      -0.917
54    D      -1.027
55    Q      -1.191
56    H      -0.985
57    I      -0.032
58    Q      -0.358
59    L       0.664
60    Q      -0.760
61    L       0.104
62    S      -0.715
63    A       0.669
64    E      -0.494
65    S      -0.352
66    V      -0.692
67    G       1.092
68    E      -1.013
69    V       1.023
70    Y      -0.633
71    I       1.132
72    K      -0.699
73    S       0.944
74    T      -0.418
75    E      -1.129
76    T       1.126
77    G      -0.635
78    Q      -0.413
79    Y       1.654
80    L       1.519
81    A       1.118
82    M       1.599
83    D       0.345
84    T      -0.912
85    D      -0.585
86    G       2.196
87    L      -1.031
88    L       1.075
89    Y      -0.172
90    G       1.623
91    S      -0.219
92    Q      -1.071
93    T      -1.186
94    P      -0.858
95    N       0.019
96    E      -0.909
97    E       0.588
98    C       1.526
99    L      -0.912
100   F       0.883
101   L      -0.876
102   E       0.666
103   R      -1.192
104   L      -0.122
105   E      -0.501
106   E      -0.240
107   N       0.926
108   H      -0.519
109   Y       1.882
110   N      -0.015
111   T       0.145
112   Y       2.796
113   I      -0.872
114   S       1.392
115   K      -1.369
116   K      -0.696
117   H       0.993
118   A      -0.832
119   E      -0.729
120   K      -0.375
121   N      -0.787
122   W       0.108
123   F       1.046
124   V       2.476
125   G       1.721
126   L       1.539
127   K       0.078
128   K      -0.383
129   N      -0.500
130   G       0.824
131   S      -0.538
132   C      -0.533
133   K       0.208
134   R      -0.580
135   G       1.091
136   P      -0.938
137   R      -0.026
138   T      -0.274
139   H      -0.777
140   Y      -0.786
141   G      -0.816
142   Q      -0.358
143   K      -0.417
144   A      -0.731
145   I       0.710
146   L       1.264
147   F       4.455
148   L       1.892
149   P       0.667
150   L       0.898
151   P      -0.213
152   V       0.667
153   S      -1.000    *
154   S      -1.000    *
155   D      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 170.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MAEGEITTFT ALTEKFNLPP GNYKKPKLLY CSNGGHFLRI LPDGTVDGTR DRSDQHIQLQ 
        70         80         90        100        110        120 LSAESVGEVY IKSTETGQYL AMDTDGLLYG SQTPNEECLF LERLEENHYN TYISKKHAEK 
       130        140        150                                  
NWFVGLKKNG SCKRGPRTHY GQKAILFLPL PVSSD

3D Structures in PDB

1JQZ (X-Ray,1.65 Å resolution)

Comments

Fibroblast growth factor-1 (FGF-1) is affiliated with numerous cellular functions such as differentiation, proliferation, and migration. Exogenous FGF-1 can be recruited into the cytosol and nucleus of cells expressing appropriate receptors, and phosphatidyl 3-kinase activity and transmembrane electrical potential have been known to be required for FGF-1 translocation. Arriving first in the cytosol, FGF-1 is shuttled into the nucleus by nuclear localization sequences found within the protein. FGF-1 is rapidly exported out of the nucleus upon phosphorylation of Ser130 by PKCδ using the CRM1 pathway. FGF-1 is dephosphorylated in the cytosol following nuclear export. The hydrophobic amino acids are crucial for active nuclear export as well as for the proliferation of NIH/3T3 cells stimulated with FGF-1.
Doubts about NES: The proposed NES failed to bind CRM1 in GST-pulldown assay (Chook Lab, unpublished results).

References

[1]. "A nuclear export sequence located on a beta-strand in fibroblast growth factor-1."
Nilsen T, Rosendal KR, Sorensen V, Wesche J, Olsnes S, Wiedlocha A. (2007) J Biol Chem, 282:26245-56 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©