NESdb

26S proteasome non-ATPase regulatory subunit 10 UniProt

26S proteasome regulatory subunit p28, Gankyrin, p28(GANK)

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Oncoprotein p28 GANK binds to RelA and retains NF-kappaB in the cytoplasm through nuclear export., Chen et al., Cell research, 2007}

*highlighted yellow in the full sequence

¹MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQ³⁸ mutated to A

Unknown

Undetermined

loop followed by α-helix (4-10)

Unknown

Show FASTA Format

>gi|20532206|sp|O75832.1|PSD10_HUMAN RecName: Full=26S proteasome non-ATPase regulatory subunit 10; AltName: Full=26S proteasome regulatory subunit p28; AltName: Full=Gankyrin; AltName: Full=p28(GANK)
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD
DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA
TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ
VAKGGLGLILKRMVEG

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 977544046999999099399999998399998976689981978999679999999999
Pred: CCCCCCHHHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHH
  AA: MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLL
              10        20        30        40        50        60


Conf: 679999988889980989999759899999999579997666789973888999709499
Pred: HCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCHH
  AA: QLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE
              70        80        90       100       110       120


Conf: 999999599998976688862865999709999999998579998866688983887987
Pred: HHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHHHHHH
  AA: IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLAC
             130       140       150       160       170       180


Conf: 5088999999998599988767799937889824999999862169
Pred: HCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHCC
  AA: DEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
             190       200       210       220

Show Conservation Score by AL2CO

1     M      -1.000    *
2     E      -1.000    *
3     G      -1.000    *
4     C      -1.000    *
5     V      -1.000    *
6     S      -1.000    *
7     N      -1.000    *
8     L      -1.000    *
9     M      -0.599
10    V       0.445
11    C       0.324
12    N      -0.635
13    L      -1.192
14    A       0.813
15    Y      -1.377
16    S      -1.425
17    G      -1.012
18    K      -0.579
19    L      -1.192
20    E      -0.738
21    E      -0.840
22    L       0.228
23    K      -0.601
24    E      -0.201
25    S      -0.948
26    I       0.861
27    L       0.018
28    A      -0.833
29    D      -0.932
30    K      -0.092
31    S      -0.629
32    L      -0.277
33    A       0.387
34    T      -0.813
35    R      -0.767
36    T      -0.894
37    D      -0.575
38    Q      -0.937
39    D      -1.005
40    S      -0.320
41    R      -1.503
42    T       0.834
43    A       0.181
44    L       2.486
45    H      -0.308
46    W      -1.398
47    A       1.241
48    C      -0.491
49    S      -1.444
50    A      -1.162
51    G       0.021
52    H      -0.851
53    T      -0.732
54    E      -0.306
55    I      -0.033
56    V       0.357
57    E      -0.342
58    F      -0.191
59    L       2.143
60    L       1.364
61    Q      -0.607
62    L      -0.951
63    G       1.287
64    V       0.905
65    P       0.901
66    V       1.268
67    N       0.240
68    D      -0.591
69    K      -0.157
70    D      -0.274
71    D      -0.803
72    A      -1.020
73    G      -0.136
74    W      -1.413
75    S       1.822
76    P       0.368
77    L       2.139
78    H      -0.257
79    I      -1.267
80    A       1.163
81    A      -0.420
82    S      -1.499
83    A      -0.932
84    G      -0.025
85    R      -0.737
86    D      -0.130
87    E       0.276
88    I       0.146
89    V       0.792
90    K       0.309
91    A      -0.367
92    L       2.179
93    L       1.608
94    G      -0.930
95    K      -0.717
96    G       1.385
97    A       1.397
98    Q       0.169
99    V       0.999
100   N       0.415
101   A      -0.341
102   V      -0.403
103   N      -0.323
104   Q      -0.715
105   N      -0.765
106   G       0.527
107   C      -1.482
108   T       2.193
109   P       0.350
110   L       2.418
111   H      -0.260
112   Y      -1.288
113   A       1.136
114   A      -0.318
115   S      -1.554
116   K      -1.036
117   N      -0.189
118   R      -0.881
119   H      -0.396
120   E       0.198
121   I      -0.119
122   A       0.782
123   V      -0.309
124   M       0.062
125   L       2.265
126   L       1.609
127   E      -0.743
128   G      -0.730
129   G       1.793
130   A       1.350
131   N       1.370
132   P       0.895
133   D       0.313
134   A      -0.073
135   K       0.355
136   D      -0.022
137   H      -0.574
138   Y      -0.790
139   E       0.263
140   A      -1.552
141   T       2.086
142   A       0.389
143   M       1.994
144   H      -0.487
145   R      -1.291
146   A       0.882
147   A      -0.294
148   A      -1.623
149   K      -1.202
150   G      -0.145
151   N      -0.820
152   L      -0.644
153   K       0.266
154   M      -0.047
155   I       0.647
156   H       0.144
157   I       0.297
158   L       2.241
159   L       1.368
160   Y      -0.952
161   Y      -0.800
162   K       0.941
163   A       1.531
164   S       0.821
165   T       0.483
166   N       0.702
167   I      -0.366
168   Q       0.085
169   D      -0.027
170   T      -0.945
171   E      -1.213
172   G       0.589
173   N      -1.615
174   T       1.665
175   P       0.435
176   L       1.526
177   H      -0.631
178   L      -1.378
179   A       1.434
180   C      -0.361
181   D      -1.545
182   E      -1.160
183   E      -0.423
184   R      -0.804
185   V      -0.609
186   E       0.466
187   E      -0.249
188   A       0.775
189   K       0.193
190   L       0.008
191   L       2.683
192   V       0.825
193   S      -0.793
194   Q      -0.781
195   G       1.650
196   A       1.107
197   S       0.451
198   I       0.819
199   Y       0.053
200   I      -0.020
201   E      -0.199
202   N       0.286
203   K      -0.700
204   E      -1.105
205   E       0.411
206   K      -1.592
207   T       1.564
208   P       0.529
209   L       1.341
210   Q      -0.628
211   V      -1.362
212   A       1.803
213   K      -0.570
214   G      -1.185
215   G       0.200
216   L      -0.746
217   G      -1.025
218   L      -0.490
219   I      -0.080
220   L       0.423
221   K      -0.370
222   R      -0.506
223   M       1.623
224   V       0.967
225   E      -1.000    *
226   G      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 173.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MEGCVSNLMV CNLAYSGKLE ELKESILADK SLATRTDQDS RTALHWACSA GHTEIVEFLL 
        70         80         90        100        110        120 QLGVPVNDKD DAGWSPLHIA ASAGRDEIVK ALLGKGAQVN AVNQNGCTPL HYAASKNRHE 
       130        140        150        160        170        180 IAVMLLEGGA NPDAKDHYEA TAMHRAAAKG NLKMIHILLY YKASTNIQDT EGNTPLHLAC 
       190        200        210        220                       DEERVEEAKL LVSQGASIYI ENKEEKTPLQ VAKGGLGLIL KRMVEG

1QYM (X-Ray,2.80 Å resolution)

p28GANK is an anti-apoptotic oncoprotein overexpressed in hepatocellular carcinomas and involved in the degradation of p53 and Rb. The protein binds directly to NF-κB/RelA and exports RelA resulting in the cytoplasmic retention of NF-κB/RelA. p28GANK's multiple NES reinforces its ability to prevent nuclear translocation of NF-κB/RelA. p28GANK is a protein other than the known IKβ family molecules that associate with NF-κB and regulate its cytoplasmic retention under basal conditions.

[1]. "Oncoprotein p28 GANK binds to RelA and retains NF-kappaB in the cytoplasm through nuclear export."
Chen Y, Li HH, Fu J, Wang XF, Ren YB, Dong LW, Tang SH, Liu SQ, Wu MC, Wang HY. (2007) Cell research, 17:1020-9 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©