NESdb

Uncharacterized protein C12orf52 UniProt

None

Homo sapiens (Human)

LMB Sensitive ^{Ref.1RITA, a novel modulator of Notch signalling, acts via nuclear export of RBP-J., Wacker et al., EMBO J, 2010}

*highlighted yellow in the full sequence

L7A/L15A/L17A ^{Ref.1RITA, a novel modulator of Notch signalling, acts via nuclear export of RBP-J., Wacker et al., EMBO J, 2010}

Unknown

Undetermined

Unknown

Show FASTA Format

>gi|74732175|sp|Q96K30.1|CL052_HUMAN RecName: Full=Uncharacterized protein C12orf52
MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKANRTRGVGKEA
SKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSEGASFGAPRMAKGDAAKLRAL
LWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADSQKLSMGGLHSSRPLKRGLSHSLTHLNVPST
GHPATSAPHTNGPQDLRPSTSGVTFRSPLVTSRARSVSISVPSTPRRGGATQKPKPPWK

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988511200100002445768896124214764211367999999999999999852268
Pred: CCCCCHHHHCCCCCCCCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MKTPVELAVSGMQTLGLQHRCRGGYRVKARTSYVDETLFGSPAGTRPTPPDFDPPWVEKA
              10        20        30        40        50        60


Conf: 888888777322268999988799999999989999997763457999657788799999
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: NRTRGVGKEASKALGAKGSCETTPSRGSTPTLTPRKKNKYRPISHTPSYCDESLFGSRSE
              70        80        90       100       110       120


Conf: 987798865555110002223489999999999999999987679999999999998898
Pred: CCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: GASFGAPRMAKGDAAKLRALLWTPPPTPRGSHSPRPREAPLRAIHPAGPSKTEPGPAADS
             130       140       150       160       170       180


Conf: 874489989999988798876555789999999999999999999999997555579855
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: QKLSMGGLHSSRPLKRGLSHSLTHLNVPSTGHPATSAPHTNGPQDLRPSTSGVTFRSPLV
             190       200       210       220       230       240


Conf: 87765000016898999999999999999
Pred: CCCCCCEEECCCCCCCCCCCCCCCCCCCC
  AA: TSRARSVSISVPSTPRRGGATQKPKPPWK
             250       260

Show Conservation Score by AL2CO

1     M       1.548
2     K       0.880
3     T      -0.577
4     P       1.017
5     V       0.233
6     E       0.053
7     L       0.693
8     A       0.566
9     V       0.046
10    S       0.501
11    G       1.359
12    M      -0.458
13    Q       0.393
14    T       0.695
15    L       0.196
16    G      -0.964
17    L      -0.480
18    Q      -0.191
19    H      -0.655
20    R       0.218
21    C      -0.697
22    R       0.129
23    G      -0.545
24    G      -0.569
25    Y       0.115
26    R       0.502
27    V      -0.647
28    K      -0.043
29    A       0.335
30    R      -0.567
31    T      -0.122
32    S       2.491
33    Y       0.427
34    V       1.875
35    D       2.464
36    E       2.464
37    T       1.140
38    L       2.464
39    F       2.464
40    G       1.378
41    S      -0.138
42    P       0.148
43    A      -0.419
44    G       0.036
45    T      -0.858
46    R       0.067
47    P       0.093
48    T      -0.550
49    P      -0.329
50    P       0.012
51    D      -0.796
52    F       0.409
53    D       0.622
54    P       2.503
55    P       2.260
56    W       1.336
57    V      -0.450
58    E      -1.175
59    K      -0.838
60    A      -1.073
61    N      -1.277
62    R      -0.582
63    T      -0.748
64    R      -0.562
65    G      -0.767
66    V      -1.127
67    G      -0.785
68    K      -1.287
69    E      -1.140
70    A      -1.170
71    S      -0.798
72    K      -0.860
73    A      -1.175
74    L      -0.700
75    G      -0.985
76    A      -1.132
77    K      -1.209
78    G      -0.408
79    S      -1.258
80    C      -1.340
81    E      -0.833
82    T      -0.287
83    T      -0.765
84    P      -0.202
85    S      -0.679
86    R      -0.600
87    G      -0.291
88    S      -0.544
89    T      -0.327
90    P      -0.007
91    T      -0.069
92    L      -0.858
93    T       0.468
94    P       0.954
95    R       0.688
96    K       0.324
97    K       0.201
98    N       0.220
99    K       0.692
100   Y       1.836
101   R       2.491
102   P       0.413
103   I      -0.328
104   S      -0.301
105   H       1.267
106   T       0.676
107   P       1.826
108   S       2.325
109   Y       1.168
110   C       1.220
111   D       3.205
112   E       1.759
113   S       0.841
114   L       3.205
115   F       2.499
116   G       2.539
117   S      -0.537
118   R       0.497
119   S      -0.772
120   E      -0.427
121   G       0.020
122   A      -1.047
123   S      -1.072
124   F      -0.434
125   G      -0.686
126   A      -0.003
127   P       0.797
128   R       0.626
129   M      -0.757
130   A      -0.046
131   K      -0.390
132   G       0.073
133   D      -0.216
134   A      -0.537
135   A      -0.584
136   K       0.541
137   L      -0.072
138   R      -0.514
139   A       0.438
140   L       1.967
141   L       0.793
142   W       2.226
143   T       0.237
144   P       2.302
145   P       0.416
146   P      -0.364
147   T      -0.774
148   P       0.105
149   R      -0.252
150   G      -0.818
151   S      -0.090
152   H      -0.930
153   S      -0.909
154   P      -0.659
155   R      -0.944
156   P      -0.215
157   R      -0.274
158   E      -0.810
159   A      -0.419
160   P       0.790
161   L      -0.350
162   R      -0.253
163   A       0.134
164   I       0.020
165   H       0.176
166   P       0.906
167   A      -1.243
168   G      -1.041
169   P      -0.480
170   S      -0.589
171   K      -1.073
172   T      -0.701
173   E      -1.145
174   P      -0.567
175   G      -0.529
176   P      -1.148
177   A      -0.991
178   A      -0.765
179   D      -0.289
180   S      -0.977
181   Q      -0.653
182   K      -0.657
183   L      -0.897
184   S      -0.318
185   M      -1.351
186   G      -1.153
187   G      -0.901
188   L      -1.330
189   H      -1.080
190   S      -0.738
191   S      -0.273
192   R      -0.950
193   P      -0.348
194   L      -0.750
195   K      -0.897
196   R       0.423
197   G      -0.430
198   L       0.122
199   S       0.771
200   H      -0.244
201   S       2.031
202   L       0.865
203   T       0.758
204   H      -0.651
205   L      -0.063
206   N      -1.075
207   V      -1.267
208   P       0.584
209   S      -0.080
210   T      -0.944
211   G      -0.904
212   H      -1.067
213   P      -0.672
214   A      -0.805
215   T      -0.786
216   S      -1.155
217   A      -0.773
218   P      -0.383
219   H      -1.020
220   T      -0.350
221   N      -0.387
222   G      -0.022
223   P      -0.680
224   Q      -0.957
225   D      -0.694
226   L      -0.526
227   R       0.731
228   P       0.203
229   S      -0.465
230   T      -0.180
231   S       0.053
232   G      -0.327
233   V      -0.307
234   T       0.204
235   F      -0.574
236   R       0.988
237   S      -0.021
238   P       0.359
239   L       0.331
240   V      -0.284
241   T       0.399
242   S      -0.025
243   R       0.482
244   A       0.576
245   R      -1.070
246   S       0.367
247   V      -0.146
248   S       0.469
249   I      -0.797
250   S       1.371
251   V      -0.252
252   P       0.258
253   S      -0.417
254   T      -0.969
255   P      -0.646
256   R       0.348
257   R       0.247
258   G      -0.238
259   G      -0.595
260   A      -1.094
261   T      -0.388
262   Q      -0.354
263   K       0.351
264   P       0.582
265   K       1.530
266   P       2.475
267   P       2.445
268   W       3.205
269   K       2.068
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 183.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MKTPVELAVS GMQTLGLQHR CRGGYRVKAR TSYVDETLFG SPAGTRPTPP DFDPPWVEKA 
        70         80         90        100        110        120 NRTRGVGKEA SKALGAKGSC ETTPSRGSTP TLTPRKKNKY RPISHTPSYC DESLFGSRSE 
       130        140        150        160        170        180 GASFGAPRMA KGDAAKLRAL LWTPPPTPRG SHSPRPREAP LRAIHPAGPS KTEPGPAADS 
       190        200        210        220        230        240 QKLSMGGLHS SRPLKRGLSH SLTHLNVPST GHPATSAPHT NGPQDLRPST SGVTFRSPLV 
       250        260                                             TSRARSVSIS VPSTPRRGGA TQKPKPPWK

Not Available

RITA is a modulator of the Notch signaling pathway. It is a nucleocytoplasm shuttling protein. RITA interacts with RBP-J, a transcription factor, and mediates its export.

[1]. "RITA, a novel modulator of Notch signalling, acts via nuclear export of RBP-J."
Wacker SA, Alvarado C, von Wichert G, Knippschild U, Wiedenmann J, Clauss K, Nienhaus GU, Hameister H, Baumann B, Borggrefe T, Knochel W, Oswald F (2010) EMBO J, : PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©