NESdb

Transcriptional regulator interacting with the PHD-bromodomain 2 UniProt

SERTA domain-containing protein 2

Homo sapiens (Human)

LMB Sensitive, Binds CRM1 ^{Ref.1CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein. , Cheong et al., J Biol Chem, 2008}

Unknown

*shown as red residues in the full sequence

L238A, L243A ^{Ref.1CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein. , Cheong et al., J Biol Chem, 2008}

Undetermined

Unknown

Show FASTA Format

>gi|3123047|sp|Q14140.1|SRTD2_HUMAN RecName: Full=SERTA domain-containing protein 2; AltName: Full=Transcriptional regulator interacting with the PHD-bromodomain 2; Short=TRIP-Br2
MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLR
RIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGSTTPLEACLTPASLLEDDD
DTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVKGTSSEAGTQKLDG
PQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLL
KTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988765556888756557878899999998625776555654335566403899899622
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCH
  AA: MLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMKLYNHRPLTEPSLQ
              10        20        30        40        50        60


Conf: 678999989999999966189999889999999999887568997767889999999999
Pred: HHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: KTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDL
              70        80        90       100       110       120


Conf: 999987646898887789997433445789999999999998878656688301211027
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCC
  AA: GSTTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELC
             130       140       150       160       170       180


Conf: 899850111001689889998888889899988656864335789987555788776677
Pred: CCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: PTSTSTEAATAATDSVKGTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTD
             190       200       210       220       230       240


Conf: 875554434588787468977788888888999995677521299999999999985689
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCCCCCC
  AA: LTLDDILFADIDTSMYDFDPCTSSSGTASKMAPVSADDLLKTLAPYSSQPVTPSQPFKMD
             250       260       270       280       290       300


Conf: 87312001450259
Pred: CCCCCCEEEEECCC
  AA: LTELDHIMEVLVGS
             310

Show Conservation Score by AL2CO

1     M       3.406
2     L       0.786
3     G       0.130
4     K       2.444
5     G       2.658
6     G       0.177
7     K       4.220
8     R       3.397
9     K       2.858
10    F       0.109
11    D      -0.829
12    E       0.583
13    H      -0.953
14    E       1.082
15    D       0.752
16    G      -0.486
17    L      -0.272
18    E       0.081
19    G      -0.040
20    K      -0.794
21    I      -0.425
22    V      -0.566
23    S      -0.250
24    P      -0.613
25    C      -0.841
26    D      -0.371
27    G      -0.817
28    P      -0.934
29    S      -0.418
30    K      -0.428
31    V      -0.131
32    S       0.468
33    Y       0.009
34    T      -0.164
35    L      -0.424
36    Q       0.456
37    R       0.915
38    Q       0.629
39    T       0.279
40    I       1.008
41    F       1.677
42    N       0.337
43    I       0.836
44    S       1.159
45    L       0.870
46    M      -0.670
47    K       3.523
48    L       1.404
49    Y       0.413
50    N      -0.296
51    H      -0.073
52    R       0.605
53    P      -0.244
54    L      -0.480
55    T      -0.146
56    E       1.208
57    P       2.552
58    S       0.667
59    L       3.463
60    Q       0.694
61    K       1.926
62    T       0.499
63    V       2.370
64    L       2.566
65    I       2.155
66    N       0.353
67    N       3.070
68    M       1.476
69    L       1.626
70    R       0.514
71    R       0.543
72    I       1.428
73    Q       0.661
74    E      -0.216
75    E       0.282
76    L       0.626
77    K      -0.356
78    Q      -0.406
79    E       0.413
80    G      -0.443
81    S      -0.585
82    L      -0.687
83    R      -0.572
84    P       0.059
85    M      -0.230
86    F      -0.498
87    T      -0.677
88    P      -0.227
89    S      -0.506
90    S      -0.256
91    Q      -0.673
92    P      -0.428
93    T      -0.589
94    T      -0.919
95    E      -0.924
96    P      -0.482
97    S      -0.674
98    D      -0.775
99    S      -0.614
100   Y      -1.044
101   R      -0.597
102   E      -0.431
103   A      -0.737
104   P      -0.418
105   P      -0.571
106   A      -1.004
107   F      -0.690
108   S      -0.466
109   H      -0.682
110   L      -0.571
111   A      -0.632
112   S      -0.812
113   P      -0.769
114   S      -0.499
115   S      -0.833
116   H      -0.703
117   P      -0.581
118   C      -0.995
119   D      -0.450
120   L      -0.789
121   G      -1.070
122   S      -0.759
123   T      -0.704
124   T      -0.808
125   P      -0.662
126   L      -0.786
127   E      -0.143
128   A      -0.668
129   C      -0.877
130   L      -0.852
131   T      -0.498
132   P      -0.130
133   A      -0.769
134   S      -0.833
135   L      -0.515
136   L      -0.623
137   E      -0.765
138   D      -0.154
139   D       0.409
140   D      -0.555
141   D      -0.727
142   T      -0.370
143   F      -0.434
144   C      -0.516
145   T      -0.421
146   S      -0.568
147   Q      -0.660
148   A      -0.840
149   M      -0.806
150   Q      -0.814
151   P      -0.921
152   T      -0.988
153   A      -0.995
154   P      -0.993
155   T      -0.589
156   K      -0.881
157   L      -0.911
158   S      -0.888
159   P      -0.709
160   P      -0.310
161   A      -1.040
162   L      -1.019
163   L      -1.090
164   P      -0.672
165   E      -0.618
166   K      -0.894
167   D      -0.500
168   S      -0.605
169   F      -0.919
170   S      -0.526
171   S      -0.291
172   A      -0.752
173   L      -0.959
174   D      -0.275
175   E      -0.519
176   I      -0.437
177   E      -0.359
178   E      -0.787
179   L      -0.676
180   C      -0.647
181   P      -0.451
182   T      -0.587
183   S      -0.742
184   T      -0.893
185   S      -0.968
186   T      -0.385
187   E      -0.801
188   A      -0.481
189   A      -0.642
190   T      -1.056
191   A      -0.932
192   A      -0.930
193   T      -0.554
194   D      -0.523
195   S      -1.017
196   V      -0.498
197   K      -0.770
198   G      -0.880
199   T      -0.911
200   S      -0.880
201   S      -0.491
202   E      -0.772
203   A      -0.548
204   G      -0.730
205   T      -0.594
206   Q      -0.842
207   K      -0.932
208   L      -0.936
209   D      -0.450
210   G      -0.771
211   P      -0.641
212   Q      -0.657
213   E      -0.456
214   S      -0.507
215   R      -0.497
216   A      -0.759
217   D      -0.477
218   D      -0.707
219   S      -0.571
220   K      -0.138
221   L      -0.642
222   M      -0.156
223   D       0.177
224   S      -0.417
225   L      -0.388
226   P       0.133
227   G       0.044
228   N       0.306
229   F       0.355
230   E       0.771
231   I      -0.770
232   T      -0.637
233   T      -0.326
234   S       0.491
235   T      -0.185
236   G       1.397
237   F      -0.305
238   L       0.212
239   T      -0.271
240   D       1.430
241   L       0.131
242   T       0.618
243   L       0.229
244   D       0.931
245   D       1.740
246   I       0.051
247   L       2.046
248   F       1.210
249   A       0.394
250   D       2.590
251   I       0.646
252   D       2.787
253   T       0.564
254   S       1.110
255   M       0.710
256   Y       1.086
257   D       1.602
258   F       0.026
259   D       1.339
260   P      -0.011
261   C      -0.466
262   T      -0.057
263   S       0.532
264   S      -0.049
265   S      -0.433
266   G      -0.495
267   T      -0.247
268   A       0.181
269   S      -0.258
270   K       0.066
271   M      -0.344
272   A      -0.018
273   P      -0.333
274   V      -0.799
275   S      -0.127
276   A      -0.565
277   D       0.227
278   D       0.567
279   L      -0.573
280   L      -0.352
281   K      -0.163
282   T      -0.288
283   L       0.396
284   A      -0.035
285   P      -0.029
286   Y      -0.696
287   S      -0.164
288   S      -0.572
289   Q      -0.066
290   P       0.623
291   V      -0.274
292   T       0.110
293   P      -0.300
294   S      -0.027
295   Q       0.079
296   P      -0.373
297   F       0.130
298   K       0.047
299   M      -0.151
300   D       1.666
301   L       0.076
302   T       0.304
303   E       2.914
304   L       0.997
305   D       2.534
306   H       0.575
307   I       1.069
308   M       1.495
309   E       1.176
310   V       2.037
311   L       1.910
312   V       2.342
313   G       1.149
314   S       2.352
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 192.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MLGKGGKRKF DEHEDGLEGK IVSPCDGPSK VSYTLQRQTI FNISLMKLYN HRPLTEPSLQ 
        70         80         90        100        110        120 KTVLINNMLR RIQEELKQEG SLRPMFTPSS QPTTEPSDSY REAPPAFSHL ASPSSHPCDL 
       130        140        150        160        170        180 GSTTPLEACL TPASLLEDDD DTFCTSQAMQ PTAPTKLSPP ALLPEKDSFS SALDEIEELC 
       190        200        210        220        230        240 
PTSTSTEAAT AATDSVKGTS SEAGTQKLDG PQESRADDSK LMDSLPGNFE ITTSTGFLTD 
       250        260        270        280        290        300 
LTLDDILFAD IDTSMYDFDP CTSSSGTASK MAPVSADDLL KTLAPYSSQP VTPSQPFKMD 
       310                                                        LTELDHIMEV LVGS

Not Available

Proto-oncogene TRIP-Br2 contains a leucine-rich nuclear export signal that overlaps with the PHD-Bromo interaction domain in its acidic C-terminal transactivation domain (TAD). The sequence, identified to be between amino acids 238-243, is required for the proper degradation of TRIP-Br2 in G2/M regardless of its ubiquitination status. Deletion of a C-terminal region including the NES was shown to increase the stability of the protein.

[1]. "CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein. "
Cheong JK, Gunaratnam L, Hsu SI. (2008) J Biol Chem, 283:11661-76 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©