NESdb

Protein C UniProt

None

Measles virus (strain Edmonston-AIK-C vaccine) (MeV) (Subacute sclerose panencephalitis virus)

LMB Sensitive ^{Ref.1The C protein of wild-type measles virus has the ability to shuttle between the nucleus and the cytoplasm, Nishie et al., Microbes Infect., 2007}

Unknown

*shown as underlined residues in the full sequence

⁷⁴RDLERAMTTLKLWES⁸⁸ ^{Ref.1The C protein of wild-type measles virus has the ability to shuttle between the nucleus and the cytoplasm, Nishie et al., Microbes Infect., 2007}

Unknown

Show FASTA Format

>gi|549403|sp|P35977.1|C_MEASA RecName: Full=Protein C
MSKTDWNASGLSRPSPSAHWPSRKLWQHGQKYQTTQDRSEPPAGKRRQAVRVSANHASQQLDQLKAVHLA
SAVRDLERAMTTLKLWESPQEISRHQALGYSVIMFMITAVKRLRESKMLTLSWFNQALMVIAPYQEETMN
LKTAMWILANLIPRDMLSLTGDLLPSLWGSGLLMLKLQKEGRSTSS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 985445458999999998888424654126633322347998877534135335402455
Pred: CCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCEEEECCCHHHHH
  AA: MSKTDWNASGLSRPSPSAHWPSRKLWQHGQKYQTTQDRSEPPAGKRRQAVRVSANHASQQ
              10        20        30        40        50        60


Conf: 568899999999998999887877337801020146766044678999987532104304
Pred: HHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCH
  AA: LDQLKAVHLASAVRDLERAMTTLKLWESPQEISRHQALGYSVIMFMITAVKRLRESKMLT
              70        80        90       100       110       120


Conf: 899999988526789998869999999984120112200135124322022467988561
Pred: HHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCHHHHHHCCCCHHHHHHHCCHHHHHHHHH
  AA: LSWFNQALMVIAPYQEETMNLKTAMWILANLIPRDMLSLTGDLLPSLWGSGLLMLKLQKE
             130       140       150       160       170       180


Conf: 167899
Pred: CCCCCC
  AA: GRSTSS

Show Conservation Score by AL2CO

1     M       1.561
2     S       1.561
3     K      -0.995
4     T      -0.162
5     D      -0.611
6     W       0.646
7     N       0.432
8     A       0.444
9     S       1.561
10    G      -1.067
11    L       0.442
12    S       0.563
13    R      -0.659
14    P      -0.517
15    S      -0.662
16    P      -0.628
17    S      -1.008
18    A      -0.617
19    H      -0.655
20    W      -1.046
21    P      -1.024
22    S      -0.144
23    R      -0.166
24    K      -0.982
25    L      -0.116
26    W      -0.168
27    Q      -0.164
28    H      -0.657
29    G      -0.039
30    Q      -1.615
31    K       0.443
32    Y      -0.087
33    Q      -1.339
34    T      -1.015
35    T      -1.061
36    Q      -1.325
37    D      -1.359
38    R      -1.043
39    S      -1.618
40    E      -1.024
41    P      -0.662
42    P      -0.672
43    A      -1.043
44    G      -1.334
45    K      -0.121
46    R      -0.150
47    R       0.428
48    Q      -0.681
49    A      -0.555
50    V      -0.168
51    R       0.646
52    V       0.446
53    S       0.677
54    A      -0.223
55    N      -0.028
56    H       1.561
57    A       0.531
58    S      -1.004
59    Q       1.561
60    Q       1.561
61    L      -0.620
62    D       1.561
63    Q       1.561
64    L      -0.622
65    K      -0.577
66    A      -0.628
67    V      -0.087
68    H      -0.971
69    L       0.435
70    A      -0.186
71    S      -0.621
72    A      -1.323
73    V       0.659
74    R      -0.105
75    D       0.667
76    L       0.531
77    E       1.561
78    R      -0.936
79    A      -0.601
80    M      -1.028
81    T      -0.642
82    T      -1.597
83    L      -0.150
84    K      -1.359
85    L      -0.984
86    W      -1.573
87    E      -0.668
88    S      -0.995
89    P      -1.018
90    Q      -1.017
91    E      -1.305
92    I      -0.620
93    S      -1.294
94    R      -1.617
95    H      -1.617
96    Q      -1.023
97    A      -1.030
98    L       0.567
99    G      -1.020
100   Y       1.561
101   S       0.435
102   V       0.680
103   I       0.444
104   M       1.561
105   F       1.561
106   M      -0.059
107   I       0.566
108   T       1.561
109   A      -0.054
110   V       1.561
111   K       1.561
112   R       1.561
113   L       1.561
114   R       0.444
115   E       0.566
116   S       1.561
117   K       0.444
118   M       1.561
119   L       1.561
120   T       1.561
121   L      -0.128
122   S       1.561
123   W       1.561
124   F       0.531
125   N      -0.681
126   Q       1.561
127   A      -0.056
128   L       0.646
129   M      -0.623
130   V      -0.209
131   I      -0.662
132   A      -1.363
133   P      -1.044
134   Y       0.659
135   Q      -1.617
136   E       0.646
137   E       1.561
138   T      -0.667
139   M      -0.667
140   N      -0.208
141   L       1.561
142   K      -1.061
143   T      -0.128
144   A       1.561
145   M       0.531
146   W      -0.577
147   I      -0.105
148   L       1.561
149   A       1.561
150   N      -0.679
151   L      -0.180
152   I       1.561
153   P       1.561
154   R      -0.632
155   D       0.659
156   M      -0.211
157   L       1.561
158   S      -0.670
159   L       0.566
160   T       1.561
161   G       1.561
162   D       1.561
163   L       0.531
164   L       1.561
165   P      -0.041
166   S      -0.986
167   L       0.566
168   W      -1.363
169   G      -0.617
170   S      -1.061
171   G      -0.162
172   L      -0.659
173   L      -0.150
174   M       0.646
175   L       0.493
176   K       0.566
177   L      -1.000    *
178   Q      -1.000    *
179   K      -1.000    *
180   E      -1.000    *
181   G      -1.000    *
182   R      -1.000    *
183   S      -1.000    *
184   T      -1.000    *
185   S      -1.000    *
186   S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 195.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MSKTDWNASG LSRPSPSAHW PSRKLWQHGQ KYQTTQDRSE PPAGKRRQAV RVSANHASQQ 
        70         80         90        100        110        120 
LDQLKAVHLA SAVRDLERAM TTLKLWESPQ EISRHQALGY SVIMFMITAV KRLRESKMLT 
       130        140        150        160        170        180 LSWFNQALMV IAPYQEETMN LKTAMWILAN LIPRDMLSLT GDLLPSLWGS GLLMLKLQKE 
                                                                  GRSTSS

Not Available

Protein C is a small and non-structural protein in measles virus with unknown functions. Wild-type C protein is nuclear but has the ability to shuttle.

[1]. "The C protein of wild-type measles virus has the ability to shuttle between the nucleus and the cytoplasm"
Nishie T, Nagata K, Takeuchi K. (2007) Microbes Infect., 9:344-54 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©