NESdb

Cyclin-dependent kinase inhibitor 1 UniProt

CDK-interacting protein 1
Melanoma differentiation-associated protein 6
MDA-6
p21

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Cytoplasmic localization and ubiquitination of p21(Cip1) by reactive oxygen species., Hwang et al., Biochem Biophys Res Commun, 2007}

*highlighted yellow in the full sequence

L71A/L73A/L76A/L78A/L113A/L115A ^{Ref.1Cytoplasmic localization and ubiquitination of p21(Cip1) by reactive oxygen species., Hwang et al., Biochem Biophys Res Commun, 2007}

Unknown

Undetermined

Unknown

Show FASTA Format

>gi|729143|sp|P38936.3|CDN1A_HUMAN RecName: Full=Cyclin-dependent kinase inhibitor 1; AltName: Full=CDK-interacting protein 1; AltName: Full=Melanoma differentiation-associated protein 6; Short=MDA-6; AltName: Full=p21
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRG
LGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGR
KRRQTSMTDFYHSKRRLIFSKRKP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999777788899899853259999995889899999999999999975088777797779
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
  AA: MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
              10        20        30        40        50        60


Conf: 990799814999998755689998865689999999996555899864334567654678
Pred: CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
              70        80        90       100       110       120


Conf: 99888888999999998555688998763322441377899999
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
             130       140       150       160

Show Conservation Score by AL2CO

1     M      -1.000    *
2     S      -1.000    *
3     E      -1.000    *
4     P      -1.000    *
5     A      -1.000    *
6     G      -1.000    *
7     D      -1.000    *
8     V      -0.547
9     R      -0.302
10    Q      -0.042
11    N      -0.426
12    P      -0.413
13    C      -0.194
14    G       0.005
15    S       0.011
16    K       0.142
17    A       1.120
18    C       1.259
19    R       2.922
20    R       0.103
21    L       2.929
22    F       3.634
23    G       1.954
24    P       0.622
25    V       0.664
26    D       0.797
27    S       0.075
28    E      -0.104
29    Q       0.397
30    L      -0.033
31    S      -0.189
32    R      -0.380
33    D      -0.357
34    C       0.404
35    D      -0.097
36    A      -0.527
37    L      -0.315
38    M       0.223
39    A      -0.341
40    G      -0.193
41    C      -0.531
42    I      -0.584
43    Q       0.279
44    E      -0.480
45    A      -0.201
46    R       0.051
47    E      -0.203
48    R       0.650
49    W       2.607
50    N       1.340
51    F       2.747
52    D       2.162
53    F       2.233
54    V      -0.501
55    T      -0.356
56    E       0.523
57    T      -0.183
58    P       2.927
59    L       0.076
60    E      -0.220
61    G       1.148
62    D      -0.482
63    F       0.977
64    A      -0.250
65    W       2.368
66    E       0.251
67    R      -0.311
68    V       0.420
69    R      -0.485
70    G      -0.795
71    L      -0.587
72    G      -0.391
73    L       0.304
74    P       1.620
75    K      -0.498
76    L      -0.101
77    Y       0.307
78    L      -0.496
79    P      -0.398
80    T      -0.478
81    G      -0.405
82    P      -0.567
83    R      -0.755
84    R      -0.683
85    G      -0.363
86    R      -0.824
87    D      -0.761
88    E      -0.747
89    L      -0.702
90    G      -0.819
91    G      -0.647
92    G      -0.794
93    R      -0.776
94    R      -0.782
95    P      -0.375
96    G      -0.823
97    T      -0.730
98    S      -0.843
99    P      -0.769
100   A      -0.762
101   L      -0.691
102   L      -0.913
103   Q      -0.707
104   G      -0.682
105   T      -0.699
106   A      -0.560
107   E      -0.536
108   E      -0.623
109   D      -0.597
110   H      -0.914
111   V      -0.825
112   D      -0.732
113   L      -0.869
114   S      -0.535
115   L      -0.871
116   S      -0.623
117   C      -0.692
118   T      -0.725
119   L      -0.783
120   V      -0.901
121   P      -0.586
122   R      -0.898
123   S      -0.718
124   G      -0.711
125   E      -0.801
126   Q      -0.708
127   A      -0.850
128   E      -0.645
129   G      -0.668
130   S      -0.597
131   P      -0.960
132   G      -0.648
133   G      -0.527
134   P      -0.765
135   G      -0.782
136   D      -0.627
137   S      -0.577
138   Q      -0.724
139   G      -0.444
140   R      -0.557
141   K       0.522
142   R       0.527
143   R      -0.191
144   Q       0.079
145   T       0.287
146   S      -0.146
147   M       1.294
148   T       1.558
149   D       1.801
150   F       2.020
151   Y       1.222
152   H      -0.468
153   S       0.024
154   K       1.687
155   R       2.544
156   R       2.117
157   L       0.060
158   I      -1.000    *
159   F      -1.000    *
160   S      -1.000    *
161   K      -1.000    *
162   R      -1.000    *
163   K      -1.000    *
164   P      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 210.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MSEPAGDVRQ NPCGSKACRR LFGPVDSEQL SRDCDALMAG CIQEARERWN FDFVTETPLE 
        70         80         90        100        110        120 
GDFAWERVRG LGLPKLYLPT GPRRGRDELG GGRRPGTSPA LLQGTAEEDH VDLSLSCTLV 
       130        140        150        160                       PRSGEQAEGS PGGPGDSQGR KRRQTSMTDF YHSKRRLIFS KRKP

Not Available

p21^Cip1 is a cyclin-dependent kinase involved in cell proliferation, differentiation, etc. One mechanism regulating p21^Cip1 is through degradation. Reactive oxygen species (ROS) induces cytoplasmic localization via NESs. The translocation is necessary for its degradation. However, simultaneous mutation of leucines within two proposed NESs prevents us from knowing which one is functional. In addition, nuclear localization needs to proceed cytoplasmic localization in order for p21^Cip1 degradation to occur.

[1]. "Cytoplasmic localization and ubiquitination of p21(Cip1) by reactive oxygen species."
Hwang CY, Kim IY, Kwon KS (2007) Biochem Biophys Res Commun, 358:219-25 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©