NESdb

Zinc finger protein SNAI1 UniProt

Protein snail homolog 1
Protein sna

Mus musculus (Mouse)

LMB Sensitive ^{Ref.1Phosphorylation regulates the subcellular location and activity of the snail transcriptional repressor., Dominquez et al., Mol Cell Biol, 2003}

*highlighted yellow in the full sequence

L139A/L142A ^{Ref.1Phosphorylation regulates the subcellular location and activity of the snail transcriptional repressor., Dominquez et al., Mol Cell Biol, 2003}

Unknown

*shown as underlined residues in the full sequence

⁸²SPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLAR
LSVAKDPQSR¹⁵¹ ^{Ref.1Phosphorylation regulates the subcellular location and activity of the snail transcriptional repressor., Dominquez et al., Mol Cell Biol, 2003}

Unknown

Show FASTA Format

>gi|1711413|sp|Q02085.1|SNAI1_MOUSE RecName: Full=Zinc finger protein SNAI1; AltName: Full=Protein snail homolog 1; Short=Protein sna
MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVR
PVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLA
RLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSC
SHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQESGCSGGPR

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988620025799999999764332466666788776668664579998889998899865
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLI
              10        20        30        40        50        60


Conf: 888889987679888879998988658999998889999999999999999898998675
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: WDSLLVPQVRPVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASS
              70        80        90       100       110       120


Conf: 356557999999996100013522359999998788755511258326777654269996
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCC
  AA: LEAEAFIAFPGLGQLPKQLARLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPC
             130       140       150       160       170       180


Conf: 799766435687876574335679999999802387623431578752046999856783
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCHHHHHHHHCCCCCCCCCCC
  AA: VCTTCGKAFSRPWLLQGHVRTHTGEKPFSCSHCNRAFADRSNLRAHLQTHSDVKRYQCQA
             190       200       210       220       230       240


Conf: 006763504134442037999999
Pred: HHHHHHCCCHHHHHHHCCCCCCCC
  AA: CARTFSRMSLLHKHQESGCSGGPR
             250       260

Show Conservation Score by AL2CO

1     M      -1.000    *
2     P      -1.000    *
3     R      -1.000    *
4     S      -1.000    *
5     F      -1.000    *
6     L      -1.000    *
7     V      -1.000    *
8     R      -1.000    *
9     K      -1.000    *
10    P      -1.000    *
11    S      -1.000    *
12    D      -1.000    *
13    P      -1.000    *
14    R      -1.000    *
15    R      -1.000    *
16    K      -1.000    *
17    P      -1.000    *
18    N      -1.000    *
19    Y      -1.000    *
20    S      -1.000    *
21    E      -1.000    *
22    L      -1.000    *
23    Q      -1.000    *
24    D      -1.000    *
25    A      -1.000    *
26    C      -1.000    *
27    V      -1.000    *
28    E      -1.000    *
29    F      -1.000    *
30    T      -1.000    *
31    F      -1.000    *
32    Q      -1.000    *
33    Q      -1.000    *
34    P      -1.000    *
35    Y      -1.000    *
36    D      -1.000    *
37    Q      -1.000    *
38    A      -1.000    *
39    H      -1.000    *
40    L      -0.384
41    L      -0.653
42    A      -0.504
43    A      -0.266
44    I      -0.253
45    P      -0.440
46    P      -0.153
47    P      -0.281
48    E      -0.419
49    V      -0.682
50    L      -0.897
51    N      -0.410
52    P      -0.190
53    A      -0.718
54    A      -0.465
55    S      -0.839
56    L      -0.608
57    P      -0.784
58    T      -1.054
59    L      -0.792
60    I      -1.000    *
61    W      -1.000    *
62    D       0.103
63    S      -0.643
64    L      -0.318
65    L      -0.747
66    V      -0.840
67    P      -0.305
68    Q      -0.788
69    V      -0.840
70    R      -0.812
71    P      -0.495
72    V      -0.627
73    A      -0.239
74    W      -0.479
75    A      -0.181
76    T      -0.597
77    L      -0.602
78    P      -0.773
79    L      -0.587
80    R      -0.835
81    E      -0.325
82    S      -0.449
83    P      -0.322
84    K       0.017
85    A      -0.829
86    V      -0.313
87    E      -0.697
88    L      -1.065
89    T      -0.639
90    S      -0.641
91    L      -0.008
92    S      -0.939
93    D      -0.879
94    E      -0.316
95    D      -0.740
96    S      -0.503
97    G      -0.555
98    K      -0.393
99    S      -0.483
100   S      -0.180
101   Q      -0.334
102   P       0.254
103   P      -0.355
104   S      -0.359
105   P      -0.655
106   P      -0.341
107   S      -0.854
108   P      -0.764
109   A      -0.405
110   P      -0.675
111   S       0.193
112   S      -0.580
113   F      -0.354
114   S      -0.865
115   S      -0.979
116   T      -1.015
117   S      -0.627
118   A      -1.077
119   S      -0.595
120   S      -0.955
121   L      -0.950
122   E       0.035
123   A      -0.637
124   E       0.493
125   A      -0.458
126   F      -0.688
127   I      -0.493
128   A      -0.632
129   F       0.039
130   P      -0.798
131   G      -0.530
132   L       0.331
133   G       0.250
134   Q       0.472
135   L      -0.723
136   P      -0.022
137   K      -0.705
138   Q      -0.804
139   L      -0.971
140   A      -0.584
141   R      -0.997
142   L       0.247
143   S      -0.815
144   V      -0.896
145   A       0.020
146   K      -0.022
147   D      -0.602
148   P      -0.063
149   Q      -0.243
150   S       0.212
151   R       0.097
152   K       0.520
153   I      -0.156
154   F       0.755
155   N      -0.337
156   C       1.714
157   K      -0.819
158   Y      -0.385
159   C       1.459
160   N      -0.020
161   K       0.890
162   E      -0.503
163   Y       1.558
164   L      -0.426
165   S      -0.896
166   L      -0.756
167   G      -0.401
168   A      -0.928
169   L       1.209
170   K      -0.758
171   M      -0.765
172   H       1.751
173   I      -0.397
174   R       0.107
175   S      -0.107
176   H       1.936
177   T       0.540
178   L       0.964
179   P       0.880
180   C       1.100
181   V      -0.574
182   C       2.558
183   T      -0.826
184   T      -0.267
185   C       2.715
186   G       0.830
187   K       1.223
188   A      -0.304
189   F       2.415
190   S      -0.589
191   R      -0.884
192   P      -0.706
193   W      -0.475
194   L      -0.909
195   L       1.777
196   Q      -0.629
197   G      -0.666
198   H       2.714
199   V      -0.314
200   R       0.602
201   T       0.204
202   H       2.259
203   T       0.522
204   G       1.099
205   E       0.835
206   K       0.671
207   P       0.923
208   F       1.288
209   S      -0.596
210   C       3.139
211   S      -0.776
212   H      -0.025
213   C       3.139
214   N       0.384
215   R       1.001
216   A      -0.391
217   F       2.532
218   A      -0.324
219   D      -0.975
220   R      -0.554
221   S      -0.155
222   N      -0.899
223   L       1.706
224   R      -0.822
225   A      -0.844
226   H       2.535
227   L      -0.335
228   Q       0.122
229   T       0.255
230   H       2.427
231   S       0.489
232   D       0.623
233   V       0.722
234   K       1.167
235   R       0.796
236   Y       1.790
237   Q      -0.649
238   C       2.781
239   Q      -0.852
240   A      -0.207
241   C       2.513
242   A       0.594
243   R       1.167
244   T      -0.283
245   F       2.227
246   S      -0.410
247   R      -0.808
248   M      -0.626
249   S      -0.426
250   L      -0.979
251   L       2.231
252   H      -0.757
253   K      -0.709
254   H       2.883
255   Q      -0.101
256   E       0.058
257   S      -0.226
258   G       2.169
259   C       0.001
260   S       0.025
261   G       0.633
262   G       0.883
263   P       2.950
264   R      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 211.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MPRSFLVRKP SDPRRKPNYS ELQDACVEFT FQQPYDQAHL LAAIPPPEVL NPAASLPTLI 
        70         80         90        100        110        120 
WDSLLVPQVR PVAWATLPLR ESPKAVELTS LSDEDSGKSS QPPSPPSPAP SSFSSTSASS 
       130        140        150        160        170        180 
LEAEAFIAFP GLGQLPKQLA RLSVAKDPQS RKIFNCKYCN KEYLSLGALK MHIRSHTLPC 
       190        200        210        220        230        240 VCTTCGKAFS RPWLLQGHVR THTGEKPFSC SHCNRAFADR SNLRAHLQTH SDVKRYQCQA 
       250        260                                             CARTFSRMSL LHKHQESGCS GGPR

Not Available

Snail is a transcription factor that represses the expression of E-cadherin. Repression of E-cadherin allows cells to detach from their neighbors and migrate. It is also relevant in the late steps of epithelial tumorigenesis. A leucine rich NES is located at the N-terminal regulatory region of Snail, which is functional when serines in the SRD domain (90-120) are phosphorylated. This may explain why different localization of Snail was observed in different cell line.

[1]. "Phosphorylation regulates the subcellular location and activity of the snail transcriptional repressor."
Dominguez D, Montserrat-Sentis B, Virgos-Soler A, Guaita S, Grueso J, Porta M, Puig I, Baulida J, Franci C, Garcia de Herreros A (2003) Mol Cell Biol, 23:5078-89 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©