NESdb

Summary for Protein 9b (NES ID: 214)

Full Name

Protein 9b UniProt

Alternative Names

Accessory protein 9b
ORF-9b

Organism

Human SARS CoV (severe acute respiratory syndrome coronavirus)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Intracellular localization of the SARS coronavirus protein 9b: evidence of active export from the nucleus., Moshynskyy et al., Virus Res, 2007}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L47A/L49A/L53A/L55A ^{Ref.1Intracellular localization of the SARS coronavirus protein 9b: evidence of active export from the nucleus., Moshynskyy et al., Virus Res, 2007}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

loop followed by β-strand

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|30173392|sp|P59636.1|ORF9B_CVHSA RecName: Full=Protein 9b; AltName: Full=Accessory protein 9b; AltName: Full=ORF-9b
MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARRNLDSLEARAF
QSTPIVVQMTKLATTEELPDEFVVVTAK

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999987535883222396303787752010102787899912326764175301666641
Pred: CCCCCCCCCCCCCCCCCCCEEEEEEEEHHHHHCCCCCCCCCEEEEEEEECCCCHHHHHHH
  AA: MDPNQTNVVPPALHLVDPQIQLTITRMEDAMGQGQNSADPKVYPIILRLGSQLSLSMARR
              10        20        30        40        50        60


Conf: 12346563102573379861221245789815898509
Pred: CCCHHHHHHHCCCCEEEEEECCCCCCCCCCCEEEEECC
  AA: NLDSLEARAFQSTPIVVQMTKLATTEELPDEFVVVTAK
              70        80        90

Show Conservation Score by AL2CO

1     M       0.498
2     D       0.498
3     P       0.498
4     N      -1.000    *
5     Q      -1.783
6     T       0.498
7     N       0.498
8     V       0.498
9     V       0.498
10    P      -1.780
11    P       0.498
12    A       0.498
13    L       0.498
14    H       0.498
15    L       0.498
16    V       0.498
17    D       0.498
18    P       0.498
19    Q       0.498
20    I       0.498
21    Q       0.498
22    L       0.498
23    T       0.498
24    I       0.498
25    T       0.498
26    R       0.498
27    M       0.498
28    E       0.498
29    D       0.498
30    A       0.498
31    M      -1.783
32    G      -1.783
33    Q      -1.783
34    G       0.498
35    Q       0.498
36    N       0.498
37    S      -1.783
38    A       0.498
39    D      -1.780
40    P       0.498
41    K      -1.783
42    V       0.498
43    Y       0.498
44    P       0.498
45    I       0.498
46    I       0.498
47    L       0.498
48    R       0.498
49    L       0.498
50    G       0.498
51    S       0.498
52    Q       0.498
53    L       0.498
54    S       0.498
55    L       0.498
56    S       0.498
57    M       0.498
58    A      -1.786
59    R       0.498
60    R      -1.786
61    N      -1.786
62    L      -1.786
63    D      -1.786
64    S      -1.780
65    L       0.498
66    E      -1.786
67    A       0.498
68    R       0.498
69    A      -3.130
70    F       0.498
71    Q      -1.786
72    S       0.498
73    T       0.498
74    P       0.498
75    I       0.498
76    V       0.498
77    V      -1.786
78    Q      -3.130
79    M       0.498
80    T       0.498
81    K       0.498
82    L       0.498
83    A       0.498
84    T       0.498
85    T       0.498
86    E       0.498
87    E       0.498
88    L       0.498
89    P       0.498
90    D       0.498
91    E       0.498
92    F       0.498
93    V       0.498
94    V       0.498
95    V       0.498
96    T       0.498
97    A      -1.786
98    K       0.498
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 214.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MDPNQTNVVP PALHLVDPQI QLTITRMEDA MGQGQNSADP KVYPIILRLG SQLSLSMARR 
        70         80         90                                  NLDSLEARAF QSTPIVVQMT KLATTEELPD EFVVVTAK

3D Structures in PDB

2CME (X-Ray,2.80 Å resolution)

Comments

Despite its small size, protein 9b is located to the cytoplasm. This may be due to the active export by CRM1. In crystal structure, protein 9b is a 2-fold symmetric dimer of two adjacent twisted β-sheets interlocked in a handshake manner. The NESs in the two dimers have slightly different secondary structures.

References

[1]. "Intracellular localization of the SARS coronavirus protein 9b: evidence of active export from the nucleus."
Moshynskyy I, Viswanathan S, Vasilenko N, Lobanov V, Petric M, Babiuk LA, Zakhartchouk AN (2007) Virus Res, 127:116-21 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©