NESdb

Summary for pUL4 (NES ID: 231)

Full Name

Nuclear protein UL4 UniProt

Alternative Names

None

Organism

Human herpesvirus 1 (strain F) (HHV-1) (Human herpes simplex virus 1)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Molecular determinants responsible for the subcellular localization of HSV-1 UL4 protein., Pan et al., Virol Sin, 2011} ^{Ref.2Comprehensive analysis of nuclear export of herpes simplex virus type 1 tegument proteins and their Epstein-Barr virus orthologs, Funk et al., Traffic, 2019}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

V178A/L181A/I184A/L186A, L181A/I184A/L186A ^{Ref.1Molecular determinants responsible for the subcellular localization of HSV-1 UL4 protein., Pan et al., Virol Sin, 2011} ^{Ref.2Comprehensive analysis of nuclear export of herpes simplex virus type 1 tegument proteins and their Epstein-Barr virus orthologs, Funk et al., Traffic, 2019}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

¹⁷⁸VEVLREIQL¹⁸⁶ ^{Ref.1Molecular determinants responsible for the subcellular localization of HSV-1 UL4 protein., Pan et al., Virol Sin, 2011}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|136787|sp|P10188.1|NP04_HHV11 RecName: Full=Nuclear protein UL4
MSNPQTTIAYSLCHARASLTSALPDAAQVVHVFEYGTRAIMVRGRERQDRLPRGGVVIQHTPIGLLVIID
CRAEFCAYRFIGRDSNQKLERGWDAHMYAYPFDSWVSSSRGESARSATAGILTVVWTADTIYITATIYGS
PPEETPGAAHGVGAAPPPPTTACPGTAEFLQPTADLLVEVLREIQLSPALEYADKLLGS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999933688863022347775799986479872497179996371202688995189971
Pred: CCCCCEEEEEEECCCCCCCCCCCCCCCEEEEEECCCEEEEEECCEECCCCCCCCCEEEEE
  AA: MSNPQTTIAYSLCHARASLTSALPDAAQVVHVFEYGTRAIMVRGRERQDRLPRGGVVIQH
              10        20        30        40        50        60


Conf: 785799998087621024730577777533687860789933522780788501036786
Pred: CCCEEEEEEECCCCEEEEEEECCCCCCCCCCCCCCEEEEEECCCEEECCCCCCEECCCCC
  AA: TPIGLLVIIDCRAEFCAYRFIGRDSNQKLERGWDAHMYAYPFDSWVSSSRGESARSATAG
              70        80        90       100       110       120


Conf: 299993598179999995699999999888898999999988999866678933379999
Pred: EEEEEECCCEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
  AA: ILTVVWTADTIYITATIYGSPPEETPGAAHGVGAAPPPPTTACPGTAEFLQPTADLLVEV
             130       140       150       160       170       180


Conf: 9862227666556657999
Pred: HHHHCCCCCCCCCCCCCCC
  AA: LREIQLSPALEYADKLLGS
             190

Show Conservation Score by AL2CO

1     M      -1.000    *
2     S       0.413
3     N      -0.268
4     P       1.251
5     Q      -0.249
6     T       1.321
7     T       0.413
8     I       1.763
9     A       0.296
10    Y       2.849
11    S       0.080
12    L       1.478
13    C      -0.998
14    H      -0.386
15    A       0.094
16    R      -0.704
17    A      -0.749
18    S      -0.662
19    L      -0.460
20    T      -1.134
21    S      -0.129
22    A      -0.797
23    L      -0.800
24    P       0.471
25    D      -0.735
26    A      -0.519
27    A       0.977
28    Q       2.139
29    V      -0.160
30    V       0.548
31    H       0.317
32    V      -0.203
33    F       0.975
34    E      -0.423
35    Y      -0.626
36    G       2.130
37    T      -0.188
38    R       2.849
39    A      -0.065
40    I       0.999
41    M      -0.627
42    V       0.180
43    R      -0.087
44    G      -0.592
45    R      -1.344
46    E      -0.489
47    R       0.855
48    Q       0.230
49    D       1.450
50    R      -0.959
51    L       0.403
52    P      -0.526
53    R      -0.691
54    G       1.426
55    G      -0.780
56    V      -0.109
57    V       0.290
58    I       0.994
59    Q       1.406
60    H       0.615
61    T       0.642
62    P       1.030
63    I      -0.666
64    G      -0.108
65    L       1.179
66    L      -0.060
67    V       0.513
68    I      -0.283
69    I       0.987
70    D       2.139
71    C       0.572
72    R      -0.515
73    A      -0.289
74    E       1.135
75    F       0.794
76    C       0.878
77    A       0.608
78    Y       2.849
79    R      -0.519
80    F       1.199
81    I      -1.140
82    G      -0.699
83    R       0.060
84    D      -0.731
85    S      -1.759
86    N      -1.287
87    Q      -1.202
88    K      -0.823
89    L       0.264
90    E      -0.216
91    R      -0.479
92    G      -0.955
93    W      -0.826
94    D      -0.946
95    A       0.114
96    H      -0.706
97    M       0.002
98    Y       0.050
99    A       1.180
100   Y      -0.225
101   P       2.055
102   F       2.849
103   D      -1.141
104   S      -0.480
105   W       1.644
106   V      -0.392
107   S      -0.539
108   S      -0.439
109   S       0.162
110   R      -0.611
111   G      -0.966
112   E      -0.504
113   S      -0.563
114   A      -0.448
115   R      -0.512
116   S       0.373
117   A      -1.322
118   T      -0.417
119   A       0.194
120   G       2.849
121   I       0.155
122   L      -0.045
123   T       0.193
124   V       0.332
125   V      -0.719
126   W      -0.299
127   T      -0.629
128   A      -1.345
129   D      -0.874
130   T       0.197
131   I      -0.483
132   Y       0.563
133   I       0.725
134   T       1.673
135   A       0.597
136   T       0.947
137   I       0.745
138   Y       1.517
139   G       0.223
140   S      -1.202
141   P      -0.380
142   P      -0.144
143   E      -1.091
144   E      -1.313
145   T      -0.730
146   P      -0.711
147   G      -0.924
148   A      -0.608
149   A      -0.757
150   H      -1.265
151   G      -0.903
152   V      -1.538
153   G      -1.038
154   A      -0.752
155   A      -1.186
156   P      -0.950
157   P      -0.733
158   P      -0.496
159   P      -0.428
160   T      -1.017
161   T      -0.697
162   A      -1.351
163   C      -0.856
164   P      -0.360
165   G      -0.767
166   T      -1.000
167   A      -0.483
168   E      -0.886
169   F      -1.345
170   L      -1.004
171   Q      -1.029
172   P      -0.664
173   T      -1.353
174   A      -0.517
175   D       1.504
176   L       0.683
177   L       2.849
178   V       0.136
179   E       0.323
180   V       0.891
181   L       1.216
182   R      -0.125
183   E       1.378
184   I       0.120
185   Q       0.657
186   L       1.072
187   S      -1.000    *
188   P      -1.000    *
189   A      -1.000    *
190   L      -1.000    *
191   E      -1.000    *
192   Y      -1.000    *
193   A      -1.000    *
194   D      -1.000    *
195   K      -1.000    *
196   L      -1.000    *
197   L      -1.000    *
198   G      -1.000    *
199   S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 231.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MSNPQTTIAY SLCHARASLT SALPDAAQVV HVFEYGTRAI MVRGRERQDR LPRGGVVIQH 
        70         80         90        100        110        120 TPIGLLVIID CRAEFCAYRF IGRDSNQKLE RGWDAHMYAY PFDSWVSSSR GESARSATAG 
       130        140        150        160        170        180 
ILTVVWTADT IYITATIYGS PPEETPGAAH GVGAAPPPPT TACPGTAEFL QPTADLLVEV 
       190                                                        
LREIQLSPAL EYADKLLGS

3D Structures in PDB

Not Available

Comments

pUL4 of the herpes simplex virus is a true late protein with little known functions, and is proposed to shuttle between the nucleus and cytoplasm. It has been found to co-localize with ICP22, an early protein, in small dense nuclear bodies. Pan et al. demonstrated that there is one CRM1-dependent NES at the C-terminus of pUL4. Funk et al. also found this protein to have nuclear export activity using Nuclear EXport Trapped by RAPamycin (NEX-TRAP).

References

[1]. "Molecular determinants responsible for the subcellular localization of HSV-1 UL4 protein."
Pan WW, Long J, Xing JJ, Zheng CF. (2011) Virol Sin, 26:347-56 PubMed
[2]. "Comprehensive analysis of nuclear export of herpes simplex virus type 1 tegument proteins and their Epstein-Barr virus orthologs"
Funk C, Raschbichler V, Lieber D, Wetschky J, Arnold EK, Leimser J, Biggel M, Friedel CC, Ruzsics Z, Bailer SM. (2019) Traffic, 20:152-167 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©