NESdb

ETS-related transcription factor Elf-3 UniProt

E74-like factor 3
Epithelial-restricted with serine box
Epithelium-restricted Ets protein ESX
Epithelium-specific Ets transcription factor 1 (ESE-1)

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Mapping of ESE-1 subdomains required to initiate mammary epithelial cell transformation via a cytoplasmic mechanism, Prescott et al., Mol Cancer, 2011}

*highlighted yellow in the full sequence

L107A/L110A, I279A/I282A ^{Ref.1Mapping of ESE-1 subdomains required to initiate mammary epithelial cell transformation via a cytoplasmic mechanism, Prescott et al., Mol Cancer, 2011}

Unknown

*shown as underlined residues in the full sequence

¹⁰²LCNCALEELRL¹¹², ²⁷⁵LWEFIRDILI²⁸⁴ ^{Ref.1Mapping of ESE-1 subdomains required to initiate mammary epithelial cell transformation via a cytoplasmic mechanism, Prescott et al., Mol Cancer, 2011}

NES1: partially unwinding α-helix
NES2: α-hehlix; (located at the end)

Unknown

Show FASTA Format

>gi|74739735|sp|P78545.1|ELF3_HUMAN RecName: Full=ETS-related transcription factor Elf-3; AltName: Full=E74-like factor 3; AltName: Full=Epithelial-restricted with serine box; AltName: Full=Epithelium-restricted Ets protein ESX; AltName: Full=Epithelium-specific Ets transcription factor 1; Short=ESE-1
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKT
QVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWII
ELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSS
DSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIR
DILIHPELNEGLMKWENRHEGVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRL
VYKFGKNSSGWKEEEVLQSRN

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 986331135553211113224788778899987678887653236788877876677534
Pred: CCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWL
              10        20        30        40        50        60


Conf: 349887686889999999999739999887898778871676306999999882797189
Pred: CCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHCCCHHHHHHHHCCCHHH
  AA: GEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQ
              70        80        90       100       110       120


Conf: 999764202588862247999875157540002799998889987312133456899999
Pred: HHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: LHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYH
             130       140       150       160       170       180


Conf: 999999999999999878998887788889999999999998899999989888989999
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: PGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDP
             190       200       210       220       230       240


Conf: 999998999988987865433587777899985238999998709877877502111587
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCEEEECCC
  AA: KHGKRKRGRPRKLSKEYWDCLEGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHE
             250       260       270       280       290       300


Conf: 214641419999997323599998789998999989974203446884026602689999
Pred: CEEEEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCC
  AA: GVFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNSSG
             310       320       330       340       350       360


Conf: 72232310279
Pred: CCHHHHHCCCC
  AA: WKEEEVLQSRN
             370

Show Conservation Score by AL2CO

1     M      -1.000    *
2     A      -1.000    *
3     A      -1.000    *
4     T      -1.000    *
5     C      -1.000    *
6     E      -1.000    *
7     I      -1.000    *
8     S      -1.000    *
9     N      -1.000    *
10    I      -1.000    *
11    F      -1.000    *
12    S      -1.000    *
13    N      -1.000    *
14    Y      -1.000    *
15    F      -1.000    *
16    S      -1.000    *
17    A      -1.000    *
18    M      -1.000    *
19    Y      -1.000    *
20    S      -1.000    *
21    S      -1.000    *
22    E      -1.000    *
23    D      -1.000    *
24    S      -1.000    *
25    T      -1.000    *
26    L      -1.000    *
27    A      -1.000    *
28    S      -1.000    *
29    V      -1.000    *
30    P      -1.000    *
31    P      -1.000    *
32    A      -1.000    *
33    A      -0.450
34    T      -0.128
35    F      -1.000    *
36    G      -1.000    *
37    A      -1.000    *
38    D      -1.000    *
39    D      -1.000    *
40    L      -1.000    *
41    V      -0.482
42    L      -0.406
43    T       0.095
44    L      -0.331
45    S      -0.576
46    N      -0.606
47    P      -0.018
48    Q      -0.564
49    M      -0.515
50    S      -0.357
51    L      -0.511
52    E      -0.316
53    G      -0.432
54    T      -0.605
55    E      -0.394
56    K      -0.468
57    A      -0.300
58    S      -0.333
59    W       0.011
60    L      -0.304
61    G      -0.153
62    E      -0.501
63    Q       0.065
64    P       0.913
65    Q      -0.501
66    F      -0.594
67    W       3.455
68    S       0.695
69    K      -0.435
70    T      -0.631
71    Q       1.215
72    V       1.846
73    L      -0.587
74    D      -0.324
75    W       2.616
76    I       1.146
77    S      -0.501
78    Y       0.257
79    Q      -0.136
80    V       0.109
81    E      -1.000    *
82    K      -0.030
83    N      -0.230
84    K       0.672
85    Y       0.902
86    D       0.080
87    A       0.117
88    S      -0.576
89    A      -0.590
90    I       0.081
91    D      -0.396
92    F      -0.518
93    S      -0.350
94    R      -0.725
95    C       1.054
96    D      -0.590
97    M       0.402
98    D       0.283
99    G       3.004
100   A      -0.395
101   T      -0.217
102   L       1.565
103   C       0.143
104   N      -0.514
105   C       0.870
106   A       0.235
107   L      -0.344
108   E      -0.128
109   E       0.139
110   L       1.208
111   R      -0.650
112   L      -0.535
113   V      -0.057
114   F      -0.123
115   G      -0.340
116   P      -0.573
117   L      -0.330
118   G       0.865
119   D      -0.105
120   Q      -0.506
121   L       0.377
122   H      -0.111
123   A      -0.292
124   Q      -0.204
125   L      -0.157
126   R      -0.427
127   D      -0.671
128   L      -0.159
129   T      -0.384
130   S      -0.679
131   S      -0.400
132   S      -0.612
133   S      -0.664
134   D      -0.598
135   E      -0.636
136   L      -0.681
137   S      -0.574
138   W      -0.621
139   I      -0.703
140   I      -0.612
141   E      -0.485
142   L      -0.594
143   L      -0.372
144   E      -0.592
145   K      -0.595
146   D      -0.650
147   G      -0.651
148   M      -0.709
149   A      -0.654
150   F      -0.729
151   Q      -0.620
152   E      -0.611
153   A      -0.667
154   L      -0.610
155   D      -0.811
156   P      -0.635
157   G      -0.719
158   P      -0.650
159   F      -0.666
160   D      -0.723
161   Q      -0.773
162   G      -0.610
163   S      -0.744
164   P      -0.717
165   F      -0.799
166   A      -0.730
167   Q      -0.541
168   E      -0.791
169   L      -0.526
170   L      -0.705
171   D      -0.494
172   D      -0.741
173   G      -0.767
174   Q      -0.836
175   Q      -0.728
176   A      -0.634
177   S      -0.568
178   P      -0.670
179   Y      -0.575
180   H      -0.595
181   P      -0.610
182   G      -0.768
183   S      -0.706
184   C      -0.722
185   G      -0.668
186   A      -0.806
187   G      -0.724
188   A      -0.692
189   P      -0.649
190   S      -0.692
191   P      -0.563
192   G      -0.732
193   S      -0.655
194   S      -0.632
195   D      -0.626
196   V      -0.654
197   S      -0.598
198   T      -0.736
199   A      -0.728
200   G      -0.581
201   T      -0.705
202   G      -0.644
203   A      -0.656
204   S      -0.499
205   R      -0.687
206   S      -0.518
207   S      -0.614
208   H      -0.789
209   S      -0.668
210   S      -0.651
211   D      -0.750
212   S      -0.638
213   G      -0.799
214   G      -0.649
215   S      -0.514
216   D      -0.640
217   V      -0.811
218   D      -0.526
219   L      -0.727
220   D      -0.825
221   P      -0.760
222   T      -0.529
223   D      -0.617
224   G      -0.730
225   K      -0.674
226   L      -0.852
227   F      -0.778
228   P      -0.688
229   S      -0.588
230   D      -0.753
231   G      -0.786
232   F      -0.693
233   R      -0.711
234   D      -0.683
235   C      -0.795
236   K      -0.702
237   K      -0.737
238   G      -0.657
239   D      -0.739
240   P      -0.558
241   K      -0.626
242   H      -0.728
243   G      -0.759
244   K      -0.708
245   R      -0.688
246   K      -0.719
247   R      -0.759
248   G      -0.741
249   R      -0.655
250   P      -0.520
251   R      -0.765
252   K      -0.657
253   L      -0.732
254   S      -0.700
255   K      -0.678
256   E      -0.670
257   Y      -0.785
258   W      -0.811
259   D      -0.551
260   C      -0.740
261   L      -0.605
262   E      -0.639
263   G      -0.451
264   K      -0.690
265   K      -0.517
266   S      -0.659
267   K      -0.727
268   H      -0.623
269   A      -0.583
270   P      -0.341
271   R      -0.262
272   G      -0.310
273   T      -0.072
274   H       0.147
275   L       2.230
276   W       1.432
277   E       1.079
278   F       2.055
279   I       1.317
280   R       0.210
281   D       0.275
282   I       1.284
283   L       3.455
284   I      -0.375
285   H       0.010
286   P      -0.312
287   E      -0.151
288   L      -0.436
289   N       0.103
290   E      -0.280
291   G      -0.102
292   L       0.526
293   M       1.288
294   K       0.171
295   W       2.726
296   E       0.512
297   N       0.408
298   R       0.104
299   H      -0.223
300   E      -0.205
301   G       0.264
302   V       0.576
303   F       2.412
304   K       1.804
305   F       1.088
306   L       0.208
307   R       0.527
308   S       1.522
309   E      -0.047
310   A      -0.174
311   V       2.091
312   A       2.473
313   Q       0.500
314   L       0.824
315   W       3.455
316   G       3.455
317   Q      -0.310
318   K       0.805
319   K       3.455
320   K       0.864
321   N       1.234
322   S      -0.048
323   N      -0.000
324   M       2.857
325   T       2.100
326   Y       2.653
327   E       1.768
328   K       2.477
329   L       1.991
330   S       2.110
331   R       2.857
332   A       1.905
333   M       1.534
334   R       2.363
335   Y       0.998
336   Y       2.207
337   Y       2.201
338   K       0.755
339   R       0.133
340   E       0.184
341   I       1.175
342   L       1.251
343   E      -0.107
344   R       1.157
345   V       0.627
346   D      -0.249
347   G       1.353
348   R       1.087
349   R       2.141
350   L       1.524
351   V       1.088
352   Y       2.139
353   K       1.868
354   F       2.308
355   G       0.435
356   K       0.463
357   N      -0.085
358   S       0.556
359   S      -0.358
360   G      -1.000    *
361   W      -1.000    *
362   K      -1.000    *
363   E      -1.000    *
364   E      -1.000    *
365   E      -1.000    *
366   V      -1.000    *
367   L      -1.000    *
368   Q      -1.000    *
369   S      -1.000    *
370   R      -1.000    *
371   N      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 232.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MAATCEISNI FSNYFSAMYS SEDSTLASVP PAATFGADDL VLTLSNPQMS LEGTEKASWL 
        70         80         90        100        110        120 
GEQPQFWSKT QVLDWISYQV EKNKYDASAI DFSRCDMDGA TLCNCALEEL RLVFGPLGDQ 
       130        140        150        160        170        180 LHAQLRDLTS SSSDELSWII ELLEKDGMAF QEALDPGPFD QGSPFAQELL DDGQQASPYH 
       190        200        210        220        230        240 PGSCGAGAPS PGSSDVSTAG TGASRSSHSS DSGGSDVDLD PTDGKLFPSD GFRDCKKGDP 
       250        260        270        280        290        300 
KHGKRKRGRP RKLSKEYWDC LEGKKSKHAP RGTHLWEFIR DILIHPELNE GLMKWENRHE 
       310        320        330        340        350        360 GVFKFLRSEA VAQLWGQKKK NSNMTYEKLS RAMRYYYKRE ILERVDGRRL VYKFGKNSSG 
       370                                                        WKEEEVLQSR N

2E8P (NMR)
3JTG (X-Ray,2.20 Å resolution)

ESE-1 is an epithelium-specific member of the E26 transformation-specific protein. ESE-1 initiates transformation of mammary epithelial cell via a novel non-nuclear, non-transcriptional mechanism. Prescott et al. reported that ESE-1 contains two separate CRM1-dependent NES motifs. Both can export reporter proteins. However, the authors only NES2 plays a critical role in the export and transforming function of intact ESE-1.

[1]. "Mapping of ESE-1 subdomains required to initiate mammary epithelial cell transformation via a cytoplasmic mechanism"
Prescott JD, Poczobutt JM, Tentler JJ, Walker DM, Gutierrez-Hartmann A. (2011) Mol Cancer, 10:103 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©