NESdb

Protein Rev UniProt

None

Bovine immunodeficiency virus (strain R29) (BIV) (Bovine immunodeficiency-like virus)

LMB Sensitive ^{Ref.1The bovine immunodeficiency virus Rev protein: identification of a novel nuclear import pathway and nuclear export signal among retroviral Rev/Rev-like proteins., Corredor et al., J Virol, 2012}

*highlighted yellow in the full sequence

L112A, V116A, M119A, L121A ^{Ref.1The bovine immunodeficiency virus Rev protein: identification of a novel nuclear import pathway and nuclear export signal among retroviral Rev/Rev-like proteins., Corredor et al., J Virol, 2012}

Unknown

*shown as underlined residues in the full sequence

¹¹²LEDLVRHMSL¹²¹ ^{Ref.1The bovine immunodeficiency virus Rev protein: identification of a novel nuclear import pathway and nuclear export signal among retroviral Rev/Rev-like proteins., Corredor et al., J Virol, 2012}

Unknown

Show FASTA Format

>gi|124021706|sp|P24097.2|REV_BIV29 RecName: Full=Protein Rev
MDQDLDRAERGERGGGSEELLQEEINEGRLTAREALQTWINNDSPRYVKKLRQGQPELPTSPGGGGGRGH
RARKLPGERRPGFWKSLRELVEQNRRKQERRLSGLDRRIQQLEDLVRHMSLGSPDPSTPSASVLSVNPPA
QTPLGHLPPRSYFKLKRVDCGAGWDLRTTAAPGLPICELDWIQGTK

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 940235665237899828999998734964179999987613884012332117999998
Pred: CCCHHHHHHHCCCCCCCHHHHHHHHHCCCCCHHHHHHHHHHCCCCCHHHHHHCCCCCCCC
  AA: MDQDLDRAERGERGGGSEELLQEEINEGRLTAREALQTWINNDSPRYVKKLRQGQPELPT
              10        20        30        40        50        60


Conf: 789998888888889998898337889999998766666542011346677776665314
Pred: CCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCC
  AA: SPGGGGGRGHRARKLPGERRPGFWKSLRELVEQNRRKQERRLSGLDRRIQQLEDLVRHMS
              70        80        90       100       110       120


Conf: 799999998754200289999999789985543202002599977676689999833212
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: LGSPDPSTPSASVLSVNPPAQTPLGHLPPRSYFKLKRVDCGAGWDLRTTAAPGLPICELD
             130       140       150       160       170       180


Conf: 333689
Pred: CCCCCC
  AA: WIQGTK

Show Conservation Score by AL2CO

1     M      -1.000    *
2     D      -1.000    *
3     Q      -1.000    *
4     D      -1.000    *
5     L      -1.000    *
6     D      -1.000    *
7     R      -1.000    *
8     A      -1.000    *
9     E      -1.000    *
10    R       1.261
11    G       1.261
12    E       1.261
13    R      -0.788
14    G      -0.788
15    G      -1.000    *
16    G      -0.788
17    S      -0.788
18    E      -0.788
19    E      -0.788
20    L       1.261
21    L       1.261
22    Q       1.261
23    E      -0.788
24    E      -0.788
25    I      -0.788
26    N      -0.788
27    E      -0.788
28    G       1.261
29    R      -0.788
30    L       1.261
31    T       1.261
32    A       1.261
33    R       1.261
34    E       1.261
35    A       1.261
36    L       1.261
37    Q      -0.788
38    T      -0.788
39    W       1.261
40    I      -0.788
41    N      -0.788
42    N      -0.788
43    D       1.261
44    S      -0.788
45    P      -0.788
46    R      -0.788
47    Y      -0.788
48    V       1.261
49    K      -0.788
50    K      -0.788
51    L      -0.788
52    R      -0.788
53    Q      -0.788
54    G       1.261
55    Q      -0.788
56    P      -0.788
57    E      -0.788
58    L      -1.000    *
59    P      -1.000    *
60    T       1.261
61    S      -0.788
62    P      -0.788
63    G      -0.788
64    G      -0.788
65    G      -0.788
66    G      -0.788
67    G      -0.788
68    R       1.261
69    G       1.261
70    H      -0.788
71    R       1.261
72    A      -0.788
73    R      -0.788
74    K      -0.788
75    L      -0.788
76    P      -0.788
77    G      -0.788
78    E      -0.788
79    R      -0.788
80    R       1.261
81    P      -0.788
82    G      -0.788
83    F       1.261
84    W       1.261
85    K      -0.788
86    S      -0.788
87    L       1.261
88    R       1.261
89    E      -0.788
90    L       1.261
91    V       1.261
92    E      -0.788
93    Q      -0.788
94    N      -0.788
95    R      -0.788
96    R       1.261
97    K      -0.788
98    Q       1.261
99    E       1.261
100   R      -0.788
101   R       1.261
102   L      -0.788
103   S       1.261
104   G      -0.788
105   L       1.261
106   D      -0.788
107   R      -0.788
108   R       1.261
109   I      -0.788
110   Q      -0.788
111   Q      -0.788
112   L       1.261
113   E       1.261
114   D      -0.788
115   L      -0.788
116   V      -0.788
117   R      -0.788
118   H      -0.788
119   M      -0.788
120   S      -0.788
121   L       1.261
122   G      -0.788
123   S      -0.788
124   P      -0.788
125   D      -0.788
126   P      -0.788
127   S      -0.788
128   T      -0.788
129   P       1.261
130   S      -0.788
131   A       1.261
132   S      -0.788
133   V      -0.788
134   L      -0.788
135   S       1.261
136   V       1.261
137   N      -0.788
138   P       1.261
139   P       1.261
140   A      -0.788
141   Q      -0.788
142   T      -0.788
143   P       1.261
144   L      -0.788
145   G      -0.788
146   H      -0.788
147   L      -1.000    *
148   P      -1.000    *
149   P      -0.788
150   R      -0.788
151   S       1.261
152   Y      -0.788
153   F       1.261
154   K       1.261
155   L      -0.788
156   K       1.261
157   R       1.261
158   V       1.261
159   D       1.261
160   C       1.261
161   G       1.261
162   A      -0.788
163   G      -0.788
164   W      -0.788
165   D      -0.788
166   L      -0.788
167   R       1.261
168   T      -0.788
169   T      -0.788
170   A       1.261
171   A      -0.788
172   P       1.261
173   G       1.261
174   L      -0.788
175   P      -0.788
176   I       1.261
177   C      -0.788
178   E       1.261
179   L       1.261
180   D       1.261
181   W       1.261
182   I       1.261
183   Q      -0.788
184   G      -1.000    *
185   T      -1.000    *
186   K      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 235.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MDQDLDRAER GERGGGSEEL LQEEINEGRL TAREALQTWI NNDSPRYVKK LRQGQPELPT 
        70         80         90        100        110        120 
SPGGGGGRGH RARKLPGERR PGFWKSLREL VEQNRRKQER RLSGLDRRIQ QLEDLVRHMS 
       130        140        150        160        170        180 
LGSPDPSTPS ASVLSVNPPA QTPLGHLPPR SYFKLKRVDC GAGWDLRTTA APGLPICELD 
                                                                  WIQGTK

Not Available

Bovine immunodeficiency virus (BIV) shares similar properties with HIV-1 and other animal lentiviruses. Like Rev of HIV-1, Rev of BIV mediates the nuclear export of partially spliced viral RNA. Gomez Corredor et al. showed that Rev of BIV harbors a bipartie NLS (as opposed to monopartie NLS in other Revs) mediated by classical importin α/β pathway. Like Rev of HIV-1, Rev of BIV also relies on CRM1 export pathway but the NES is different from Rev of HIV-1. Note that the same article reported that I109, which resembles φ0 plays a minor role in export activity.

[1]. "The bovine immunodeficiency virus Rev protein: identification of a novel nuclear import pathway and nuclear export signal among retroviral Rev/Rev-like proteins."
Gomez Corredor A, Archambault D. (2012) J Virol, 86:4892-905 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©