NESdb

Proliferating cell nuclear antigen UniProt

Cyclin

Homo sapiens (Human)

LMB Sensitive

*highlighted yellow in the full sequence

L12A/L16A/L19A/L22A

Unknown

*shown as underlined residues in the full sequence

¹¹ILKKVLEALKDLI²³

Unknown

Show FASTA Format

>sp|P12004|PCNA_HUMAN Proliferating cell nuclear antigen OS=Homo sapiens GN=PCNA PE=1 SV=1
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 936993580348999999973111364897899538997407816899954188887501
Pred: CEEEEECCHHHHHHHHHHHHHHHCEEEEEECCCCEEEEEECCCCEEEEEEEECCCCCCCE
  AA: MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTY
              10        20        30        40        50        60


Conf: 239860223304206645100499966999971189818999971898636556875210
Pred: ECCCCEEEEEECCCHHHHHHHCCCCCEEEEEEECCCCEEEEEEECCCCCEEEEEEEEEEE
  AA: RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
              70        80        90       100       110       120


Conf: 486778999864059999711789999844622597699999799599999824414899
Pred: CCCCCCCCCCCCCEEEEEECCHHHHHHHHHHHCCCCEEEEEEECCEEEEEEEECCEEEEE
  AA: LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
             130       140       150       160       170       180


Conf: 993078887665305896446078998505343212257899608999564998189996
Pred: EEECCCCCCCCCCCEEEEECCEEEEEEEHHHHHHHHCCCCCCCEEEEEEECCCCEEEEEE
  AA: KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYK
             190       200       210       220       230       240


Conf: 489606899965788987799
Pred: ECCCEEEEEEECCCCCCCCCC
  AA: IADMGHLKYYLAPKIEDEEGS
             250       260

Show Conservation Score by AL2CO

1     M       3.345
2     F       1.959
3     E       0.187
4     A       0.658
5     R      -0.259
6     L       0.475
7     V      -1.126
8     Q      -0.379
9     G       0.493
10    S      -0.868
11    I      -0.873
12    L       1.411
13    K       0.241
14    K      -0.505
15    V       0.485
16    L       0.567
17    E      -0.376
18    A       0.433
19    L       1.015
20    K      -0.016
21    D      -0.270
22    L       0.899
23    I       1.244
24    N      -0.471
25    E       0.167
26    A       0.571
27    C      -1.036
28    W       0.851
29    D      -0.605
30    I       0.671
31    S       0.010
32    S      -0.289
33    S      -0.299
34    G       1.000
35    V       1.721
36    N      -1.112
37    L       0.796
38    Q      -0.255
39    S       0.991
40    M       1.390
41    D       3.752
42    S      -0.547
43    S       0.441
44    H       0.305
45    V       1.869
46    S       0.689
47    L       1.885
48    V       0.566
49    Q      -0.606
50    L       0.625
51    T      -1.319
52    L       1.050
53    R      -1.095
54    S      -0.841
55    E      -0.633
56    G      -0.635
57    F       2.688
58    D      -0.578
59    T      -1.209
60    Y       2.600
61    R      -0.797
62    C       0.537
63    D      -0.182
64    R      -0.982
65    N      -0.570
66    L      -0.807
67    A      -0.735
68    M       1.175
69    G       1.655
70    V       1.245
71    N      -0.120
72    L       0.590
73    T      -0.846
74    S      -1.063
75    M       1.207
76    S      -1.177
77    K       0.284
78    I       0.973
79    L       0.883
80    K       0.344
81    C      -0.780
82    A       0.143
83    G      -0.371
84    N      -0.559
85    E      -0.336
86    D       0.774
87    I      -1.042
88    I       0.588
89    T      -0.833
90    L       0.713
91    R      -0.761
92    A      -1.095
93    E      -0.993
94    D      -0.205
95    N      -0.733
96    A      -0.788
97    D      -0.899
98    T      -1.165
99    L       0.644
100   A      -1.044
101   L       0.278
102   V      -1.161
103   F      -0.181
104   E      -0.614
105   A      -0.049
106   P      -1.292
107   N      -1.106
108   Q      -1.117
109   E      -0.052
110   K      -0.432
111   V      -0.782
112   S      -0.880
113   D      -0.417
114   Y       0.217
115   E      -0.992
116   M       1.083
117   K      -0.059
118   L       0.321
119   M       0.442
120   D       0.122
121   L      -0.141
122   D      -0.360
123   V      -1.084
124   E      -0.718
125   Q      -1.048
126   L      -0.031
127   G      -0.615
128   I       0.211
129   P       0.310
130   E      -0.172
131   Q      -0.826
132   E      -0.366
133   Y       0.440
134   S      -0.682
135   C       0.482
136   V      -1.037
137   V       1.381
138   K      -0.951
139   M       0.818
140   P      -0.978
141   S       0.097
142   G      -1.017
143   E      -0.826
144   F       1.657
145   A      -0.820
146   R      -0.527
147   I      -0.067
148   C       0.364
149   R      -0.205
150   D       0.013
151   L       0.622
152   S      -0.930
153   H      -1.132
154   I       0.994
155   G       1.158
156   D       0.937
157   A      -0.881
158   V       1.125
159   V      -1.157
160   I       1.451
161   S      -1.096
162   C       0.107
163   A      -0.807
164   K      -0.284
165   D      -0.170
166   G      -0.857
167   V      -0.197
168   K      -1.259
169   F       1.081
170   S      -1.016
171   A       0.181
172   S      -0.756
173   G       2.113
174   E       0.592
175   L      -0.938
176   G       0.027
177   N      -0.882
178   G      -0.554
179   N      -0.637
180   I      -0.035
181   K      -1.145
182   L       0.192
183   S      -0.887
184   Q      -1.043
185   T      -0.781
186   S      -1.036
187   N      -0.825
188   V      -0.952
189   D      -1.032
190   K      -1.350
191   E      -0.848
192   E      -0.828
193   E      -0.707
194   A      -1.114
195   V      -0.451
196   T      -0.977
197   I      -0.440
198   E      -0.716
199   M      -0.700
200   N      -0.984
201   E      -0.030
202   P      -0.514
203   V      -0.080
204   Q      -0.689
205   L      -0.032
206   T      -0.708
207   F       2.033
208   A       0.388
209   L       0.204
210   R       0.146
211   Y       1.579
212   L       1.562
213   N      -0.916
214   F      -1.222
215   F       1.492
216   T      -0.335
217   K       0.866
218   A      -0.027
219   T      -0.532
220   P      -0.667
221   L      -0.456
222   S       0.364
223   S      -0.188
224   T      -1.319
225   V       1.205
226   T      -0.927
227   L       1.422
228   S      -1.081
229   M       1.253
230   S      -0.229
231   A      -0.821
232   D       0.409
233   V      -1.046
234   P       2.637
235   L       0.580
236   V      -0.954
237   V       0.877
238   E      -0.747
239   Y       1.657
240   K      -1.179
241   I       0.932
242   A      -0.822
243   D      -0.410
244   M      -1.304
245   G       1.218
246   H      -0.662
247   L       1.395
248   K      -0.716
249   Y       2.001
250   Y       0.974
251   L       2.463
252   A       2.485
253   P       2.670
254   K       1.556
255   I       0.491
256   E       0.293
257   D       0.574
258   E       1.349
259   E      -1.000    *
260   G      -1.000    *
261   S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 250.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MFEARLVQGS ILKKVLEALK DLINEACWDI SSSGVNLQSM DSSHVSLVQL TLRSEGFDTY 
        70         80         90        100        110        120 RCDRNLAMGV NLTSMSKILK CAGNEDIITL RAEDNADTLA LVFEAPNQEK VSDYEMKLMD 
       130        140        150        160        170        180 LDVEQLGIPE QEYSCVVKMP SGEFARICRD LSHIGDAVVI SCAKDGVKFS ASGELGNGNI 
       190        200        210        220        230        240 KLSQTSNVDK EEEAVTIEMN EPVQLTFALR YLNFFTKATP LSSTVTLSMS ADVPLVVEYK 
       250        260                                             IADMGHLKYY LAPKIEDEEG

1AXC (X-Ray,2.60 Å resolution)

The proliferating cell nuclear antigen (PCNA) is a member of DNA sliding clamp family of proteins and functions in cell cycle progression, DNA replication and DNA repair. PCNA protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. PCNA protein expression and its granular/nucleoli distribution are a well-accepted marker of proliferation. However, in neutrophils, PCNA was localized exclusively in the cytoplasm due to its nuclear-to-cytoplasmic relocalization during granulocytic differentiation. The NES defined in the study of Bouayad et. al is located within the internal face of the PCNA trimer and within the DNA-interacting domain of PCNA. Thus due to its localization within the trimer, NES could not bind CRM1 in trimeric PCNA.

[1]. "Nuclear-to-cytoplasmic Relocalization of the Proliferating Cell Nuclear Antigen (PCNA) during Differentiation Involves a Chromosome Region Maintenance 1 (CRM1)-dependent Export and Is a Prerequisite for PCNA Antiapoptotic Activity in Mature Neutrophils"
Bouayad D, Pederzoli-Ribeil M, Mocek J, Candalh C, Arlet JB, Hermine O, Reuter N, Davezac N, Witko-Sarsat V. (2012) J Biol Chem, 287(40):33812-25 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©