NESdb

HTLV-1 basic leucine-zipper factor UniProt

None

Human T-cell leukemia virus type 1 (HTLV-1)

LMB Sensitive ^{Ref.1HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm., Mukai et al., Oncogene, 2014}

*highlighted yellow in the full sequence

F4A/V5A/L21A/L22A/V23A, S6A/V7A/L21A/L22A/V23A ^{Ref.1HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm., Mukai et al., Oncogene, 2014} ^{Ref.1HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm., Mukai et al., Oncogene, 2014}

Unknown

*shown as underlined residues in the full sequence

¹MVNFVSVGLFRCLPVPCPEDLLVEELVDGLLSL³³ ^{Ref.1HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm., Mukai et al., Oncogene, 2014}

Unknown

Show FASTA Format

>sp|P0C745|HBZ_HTL1C HTLV-1 basic zipper factor OS=Human T-cell leukemia virus 1 (isolate Caribbea HS-35 subtype A) OX=11927 GN=HBZ PE=1 SV=1
MVNFVSVGLFRCLPVPCPEDLLVEELVDGLLSLEEELKDKEEEETVLDGLLSLEEESRGR
LRRGPPGGKAPPRGETHRDRQRRAEEKRKRKKEREKEEEKQIAEYLKRKEEEKARRRKRA
EEKAADFARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGVDGYTRQLEGEVESLEA
ERRRLLQEKEDLMGEVNYWQGRLEAMWLQ

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 945101032210047997036788875533445787433678888854101530310043
Pred: CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCCC
  AA: MVNFVSVGLFRCLPVPCPEDLLVEELVDGLLSLEEELKDKEEEETVLDGLLSLEEESRGR
              10        20        30        40        50        60


Conf: 245888888999998403556677888777777778888999999865599999987777
Pred: CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
  AA: LRRGPPGGKAPPRGETHRDRQRRAEEKRKRKKEREKEEEKQIAEYLKRKEEEKARRRKRA
              70        80        90       100       110       120


Conf: 777777777777899999998776279986525889988881666421111113566789
Pred: HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHH
  AA: EEKAADFARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGVDGYTRQLEGEVESLEA
             130       140       150       160       170       180


Conf: 98877765431100023224466553229
Pred: HHHHHHHHHHHHHHHHHHHHHHHHHHHCC
  AA: ERRRLLQEKEDLMGEVNYWQGRLEAMWLQ
             190       200

Show Conservation Score by AL2CO

1     M      -1.000    *
2     V      -1.000    *
3     N      -1.000    *
4     F      -1.000    *
5     V      -1.000    *
6     S      -1.000    *
7     V      -1.000    *
8     G      -1.000    *
9     L      -1.000    *
10    F      -1.000    *
11    R      -1.000    *
12    C      -1.000    *
13    L      -1.000    *
14    P      -1.000    *
15    V      -1.000    *
16    P      -1.000    *
17    C      -1.000    *
18    P      -1.000    *
19    E      -1.000    *
20    D      -1.000    *
21    L      -1.000    *
22    L      -1.000    *
23    V      -1.000    *
24    E      -1.000    *
25    E      -1.000    *
26    L      -1.000    *
27    V      -1.000    *
28    D       2.388
29    G       2.388
30    L       0.681
31    L       2.388
32    S       0.681
33    L       0.681
34    E       2.388
35    E      -0.350
36    E       0.681
37    L      -0.350
38    K       0.659
39    D      -1.008
40    K       0.667
41    E      -1.056
42    E       0.917
43    E      -0.197
44    E      -0.197
45    T      -2.090
46    V      -1.056
47    L      -0.197
48    D      -1.056
49    G      -0.287
50    L      -0.966
51    L      -1.056
52    S      -0.209
53    L      -1.056
54    E      -0.197
55    E      -0.197
56    E       0.918
57    S      -0.209
58    R      -0.197
59    G      -1.070
60    R      -1.070
61    L      -0.289
62    R      -0.280
63    R      -0.963
64    G      -0.280
65    P      -0.147
66    P      -1.549
67    G      -0.289
68    G      -0.028
69    K       0.752
70    A      -1.569
71    P      -1.009
72    P      -1.000
73    R       0.657
74    G      -1.056
75    E      -0.111
76    T      -1.616
77    H      -0.196
78    R       0.737
79    D      -0.336
80    R      -1.009
81    Q      -1.023
82    R      -0.928
83    R      -0.889
84    A      -1.616
85    E       2.388
86    E       2.388
87    K      -0.068
88    R      -0.090
89    K      -0.262
90    R      -0.946
91    K      -0.217
92    K      -0.193
93    E       0.988
94    R      -0.049
95    E      -0.111
96    K      -0.196
97    E       0.737
98    E      -1.009
99    E      -0.337
100   K      -0.940
101   Q      -0.940
102   I      -1.009
103   A      -0.196
104   E       0.988
105   Y      -1.569
106   L      -1.000
107   K      -0.974
108   R      -0.090
109   K      -0.256
110   E      -0.327
111   E      -0.025
112   E      -0.215
113   K       0.071
114   A      -0.336
115   R       1.034
116   R      -0.188
117   R       1.040
118   K      -0.895
119   R      -0.998
120   A      -0.171
121   E      -0.111
122   E       0.656
123   K      -0.257
124   A       0.917
125   A      -0.334
126   D       0.809
127   F      -1.070
128   A       0.809
129   R       0.914
130   R      -0.069
131   K      -0.940
132   Q      -0.929
133   E      -0.929
134   E       2.388
135   Q      -0.966
136   E       0.988
137   R      -0.197
138   R       0.917
139   E      -0.073
140   R      -0.111
141   K       0.680
142   W      -0.289
143   R      -0.197
144   Q      -0.068
145   G      -1.438
146   A       0.695
147   E       1.034
148   K      -0.829
149   A      -0.940
150   K      -0.357
151   Q      -0.218
152   H      -1.468
153   S      -0.998
154   A      -0.196
155   R      -0.049
156   K      -0.970
157   E      -0.260
158   K      -0.069
159   M      -1.009
160   Q      -1.458
161   E      -0.069
162   L      -0.334
163   G      -0.334
164   V      -0.334
165   D       0.682
166   G       0.682
167   Y      -0.334
168   T      -1.070
169   R       2.388
170   Q       0.793
171   L      -0.334
172   E       0.793
173   G      -1.634
174   E       0.793
175   V      -0.292
176   E      -0.334
177   S      -0.334
178   L       0.793
179   E      -0.334
180   A       2.388
181   E       2.388
182   R       0.809
183   R      -0.244
184   R       0.809
185   L       2.388
186   L      -0.334
187   Q      -0.334
188   E       0.809
189   K       0.887
190   E       0.659
191   D       0.681
192   L       0.681
193   M      -0.350
194   G       0.681
195   E       2.388
196   V       2.388
197   N       0.681
198   Y       0.681
199   W       0.681
200   Q       0.681
201   G      -0.350
202   R       2.388
203   L      -1.000    *
204   E      -1.000    *
205   A      -1.000    *
206   M      -1.000    *
207   W      -1.000    *
208   L      -1.000    *
209   Q      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 267.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MVNFVSVGLF RCLPVPCPED LLVEELVDGL LSLEEELKDK EEEETVLDGL LSLEEESRGR 
        70         80         90        100        110        120 LRRGPPGGKA PPRGETHRDR QRRAEEKRKR KKEREKEEEK QIAEYLKRKE EEKARRRKRA 
       130        140        150        160        170        180 EEKAADFARR KQEEQERRER KWRQGAEKAK QHSARKEKMQ ELGVDGYTRQ LEGEVESLEA 
       190        200                                             ERRRLLQEKE DLMGEVNYWQ GRLEAMWLQ

Not Available

Viral protein HBZ is a bZIP domain containing protein that interacts with various host transcription factors and promotes growth in adult T-cell leukemia. Mukai and Oshima found that co-expression with of HBZ with GADD34 caused increased cytoplasmic localization of HBZ (possibly by retention), while HBZ accumulated in the nucleus when treated with LMB. Truncation analysis revealed the N-terminal 33 residues to be the region with NES activity, containing possibly 2 NESs. Only mutating 21-23 or 30-33 did not cause nuclear accumulation of HBZ 1-33, which supports the hypothesis that this region has 2 active NESs. HBZ-SI isoform lacks residues 1-7 and mutations of 21-23 and 30-33 equivalent residues both caused reduction in nuclear export.

[1]. "HTLV-1 HBZ positively regulates the mTOR signaling pathway via inhibition of GADD34 activity in the cytoplasm."
Mukai R, Ohshima T. (2014) Oncogene, 33:2317-28 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©