NESdb

Cyclin-dependent kinase 5 activator 1 (CDK5 activator 1) UniProt

Cyclin-dependent kinase 5 regulatory subunit 1, TPKII regulatory subunit

Mus musculus (Mouse)

LMB Sensitive ^{Ref.1p35 regulates the CRM1-dependent nucleocytoplasmic shuttling of nuclear hormone receptor coregulator-interacting factor 1 (NIF-1), Zhao et al., PLoS One, 2014}

*highlighted yellow in the full sequence

L226A/L227A/L230A ^{Ref.1p35 regulates the CRM1-dependent nucleocytoplasmic shuttling of nuclear hormone receptor coregulator-interacting factor 1 (NIF-1), Zhao et al., PLoS One, 2014}

Unknown

Undetermined

alpha-helix

Unknown

Show FASTA Format

>sp|P61809|CD5R1_MOUSE Cyclin-dependent kinase 5 activator 1 OS=Mus musculus OX=10090 GN=Cdk5r1 PE=1 SV=1
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
VSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 974243088998886657887776653100245543445867566446787612332022
Pred: CCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCC
  AA: MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
              10        20        30        40        50        60


Conf: 333678999999988964457521111002468899888999999999999888888887
Pred: CCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: KKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
              70        80        90       100       110       120


Conf: 778644799998777888860388421578997777987421024899999995112000
Pred: CCCCCCCCCCCCCCCCCCCCCEEEECHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHC
  AA: VSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
             130       140       150       160       170       180


Conf: 221323204335544572243423112232014565797888999988765550357876
Pred: CCCEEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCC
  AA: VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
             190       200       210       220       230       240


Conf: 667887420001048999989999962488677106899853789989851230232210
Pred: CCCCCCCCCCCHHHHHHHHHHHHHHHHCCHHHHHCCCCCCCHHHHHHHHHHCCCHHHHHH
  AA: ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
             250       260       270       280       290       300


Conf: 0248889
Pred: CCCCCCC
  AA: LLLGLDR

Show Conservation Score by AL2CO

1     M       2.822
2     G       2.149
3     T       1.096
4     V       0.944
5     L       1.142
6     S       2.822
7     L       0.529
8     S       0.587
9     P       1.288
10    S      -0.250
11    Y      -0.658
12    R      -0.217
13    K       0.253
14    A      -0.372
15    T      -0.696
16    L      -0.517
17    F      -1.076
18    E      -0.540
19    D      -0.230
20    G      -0.922
21    A      -0.685
22    A      -0.686
23    T      -0.995
24    V      -0.760
25    G      -0.783
26    H      -0.808
27    Y      -0.659
28    T      -0.612
29    A      -0.917
30    V      -0.666
31    Q      -1.073
32    N      -0.615
33    S      -0.506
34    K      -0.439
35    N      -0.433
36    A      -0.711
37    K      -0.849
38    D      -0.259
39    K      -0.023
40    N      -0.658
41    L      -0.293
42    K       0.703
43    R       0.419
44    H      -0.253
45    S      -0.562
46    I      -0.080
47    I       0.549
48    S       0.152
49    V      -0.058
50    L       0.890
51    P       0.508
52    W       0.621
53    K       0.302
54    R       0.083
55    I       0.103
56    V      -0.316
57    A      -0.496
58    V      -0.812
59    S      -0.666
60    A      -0.269
61    K       0.080
62    K      -0.473
63    K      -0.752
64    N      -0.677
65    S      -0.877
66    K      -0.818
67    K      -0.877
68    A      -0.886
69    Q      -0.992
70    P      -0.783
71    N      -0.663
72    S      -1.091
73    S      -1.048
74    Y      -1.042
75    Q      -1.002
76    S      -0.980
77    N      -0.872
78    I      -1.065
79    A      -1.027
80    H      -0.948
81    L      -0.961
82    N      -0.474
83    N      -0.852
84    E      -0.692
85    N      -0.367
86    L      -0.671
87    K      -0.522
88    K      -0.612
89    S      -0.509
90    L      -0.997
91    S      -0.831
92    C      -1.085
93    A      -1.141
94    N      -0.871
95    L      -1.035
96    S      -0.774
97    T      -1.070
98    F      -1.201
99    A      -1.203
100   Q      -0.927
101   P      -0.959
102   P      -0.984
103   P      -1.033
104   A      -0.927
105   Q      -0.872
106   P      -0.929
107   P      -0.988
108   A      -1.021
109   P      -0.826
110   P      -1.127
111   A      -0.956
112   S      -1.057
113   Q      -1.069
114   L      -1.115
115   S      -1.167
116   G      -1.180
117   S      -1.006
118   Q      -1.095
119   T      -1.076
120   G      -1.047
121   V      -1.036
122   S      -0.990
123   S      -0.912
124   S      -1.005
125   V      -1.007
126   K      -1.059
127   K      -1.090
128   A      -0.964
129   P      -0.896
130   H      -1.085
131   P      -0.850
132   A      -1.097
133   I      -1.087
134   T      -1.078
135   S      -0.904
136   A      -1.102
137   G      -1.111
138   T      -0.645
139   P      -0.442
140   K       0.080
141   R      -0.129
142   V      -0.258
143   I      -0.569
144   V      -0.722
145   Q      -0.242
146   A      -0.008
147   S      -0.017
148   T       0.694
149   S       0.133
150   E       0.575
151   L       1.190
152   L       1.579
153   R      -0.059
154   C       0.526
155   L       1.256
156   G       1.599
157   E      -0.943
158   F       1.633
159   L       0.522
160   C      -0.661
161   R      -0.658
162   R       0.379
163   C       1.707
164   Y      -1.137
165   R      -0.060
166   L       1.192
167   K      -0.644
168   H      -0.625
169   L       0.617
170   S      -0.788
171   P      -0.009
172   T      -0.675
173   D      -0.125
174   P      -0.228
175   V       0.097
176   L      -0.290
177   W       2.822
178   L       0.800
179   R       0.590
180   S      -0.688
181   V       1.133
182   D       2.051
183   R       0.271
184   S       0.024
185   L       2.387
186   L       0.674
187   L       0.021
188   Q       0.309
189   G       0.727
190   W       0.844
191   Q       1.677
192   D      -0.208
193   Q      -0.419
194   G      -0.307
195   F       1.361
196   I       1.053
197   T       0.025
198   P       0.951
199   A       0.199
200   N       0.331
201   V       0.797
202   V       0.976
203   F       1.407
204   L       0.397
205   Y       1.537
206   M       1.020
207   L       0.911
208   C       0.312
209   R       0.824
210   D      -0.047
211   V      -0.317
212   I       0.265
213   S      -0.693
214   S      -0.253
215   E      -0.214
216   V       0.269
217   G      -0.878
218   S      -0.221
219   D      -0.380
220   H      -1.060
221   E       0.393
222   L       1.199
223   Q       0.338
224   A      -0.209
225   V      -0.560
226   L       0.544
227   L       0.936
228   T       0.008
229   C       1.445
230   L       1.181
231   Y       1.731
232   L       0.300
233   S       0.880
234   Y       1.569
235   S       0.732
236   Y       2.282
237   M       0.538
238   G       1.824
239   N       0.514
240   E       1.836
241   I       1.662
242   S       1.728
243   Y       2.310
244   P       1.876
245   L       0.257
246   K       0.440
247   P       1.489
248   F       2.311
249   L       1.013
250   V      -0.048
251   E       0.005
252   S      -0.929
253   C      -0.503
254   K       0.904
255   E      -0.196
256   A      -0.771
257   F       2.322
258   W       2.313
259   D      -0.377
260   R       0.109
261   C       0.561
262   L       0.568
263   S      -1.164
264   V       0.827
265   I       0.526
266   N      -0.505
267   L      -0.870
268   M      -0.471
269   S       2.822
270   S      -0.783
271   K      -0.058
272   M       2.331
273   L       2.822
274   Q       0.455
275   I       0.818
276   N       2.822
277   A      -0.227
278   D       0.604
279   P       0.502
280   H      -0.567
281   Y       0.640
282   F       2.149
283   T       0.451
284   Q       0.385
285   V       0.603
286   F       0.811
287   S      -0.038
288   D       1.431
289   L       2.239
290   K       1.456
291   N      -0.619
292   E      -0.249
293   S      -0.463
294   G      -0.701
295   Q      -0.809
296   E      -0.898
297   D      -0.167
298   K      -1.000    *
299   K      -1.000    *
300   R      -1.000    *
301   L      -1.000    *
302   L      -1.000    *
303   L      -1.000    *
304   G      -1.000    *
305   L      -1.000    *
306   D      -1.000    *
307   R      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 273.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MGTVLSLSPS YRKATLFEDG AATVGHYTAV QNSKNAKDKN LKRHSIISVL PWKRIVAVSA 
        70         80         90        100        110        120 KKKNSKKAQP NSSYQSNIAH LNNENLKKSL SCANLSTFAQ PPPAQPPAPP ASQLSGSQTG 
       130        140        150        160        170        180 VSSSVKKAPH PAITSAGTPK RVIVQASTSE LLRCLGEFLC RRCYRLKHLS PTDPVLWLRS 
       190        200        210        220        230        240 
VDRSLLLQGW QDQGFITPAN VVFLYMLCRD VISSEVGSDH ELQAVLLTCL YLSYSYMGNE 
       250        260        270        280        290        300 ISYPLKPFLV ESCKEAFWDR CLSVINLMSS KMLQINADPH YFTQVFSDLK NESGQEDKKR 
                                                                  LLLGLDR

1UNL (X-Ray,2.2 Å resolution)
3O0G (X-Ray,1.95 Å resolution)

p35 is one of the neuronal-specific activator of Cyclin-dependent kinase 5 (Cdk5) and is critical for neuronal cell positioning and migration. Cdk5/p35 are found in both plasma membrane and nucleus. Zhao et al. identified a putative NES in the region 222-233 where leucine mutations and LMB caused nuclear accumulation of full length protein. They also found that it interacts with NIF1, a transcriptional regulator and regulates its cellular localization, independent of Cdk5 activity. However, based on the available X-ray structures, the putative NES appears to be in the center of a helical domain surrounded by 4 other helices. Note that rat, mouse and human p35 are highly conserved. Mouse UNIPROT is provided in this entry as mouse cDNA library was used in the study references.

[1]. "p35 regulates the CRM1-dependent nucleocytoplasmic shuttling of nuclear hormone receptor coregulator-interacting factor 1 (NIF-1)"
Zhao XS, Fu WY, Chien WW, Li Z, Fu AK, Ip NY. (2014) PLoS One, 9(10):e110584 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©