NESdb

Plasmodium falciparum ARM Repeats Only UniProt

Armadillo-domain containing rhoptry protein

Plasmodium falciparum

LMB Sensitive ^{Ref.1Evidence for the Nucleo-Apical Shuttling of a Beta-Catenin Like Plasmodium falciparum Armadillo Repeat Containing Protein, Mitra et al., PLoS One, 2016}

Unknown

*shown as underlined residues in the full sequence

alpha helix and loop

Unknown

Show FASTA Format

>tr|C0H4A5|C0H4A5_PLAF7 Armadillo-domain containing rhoptry protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0414900 PE=4 SV=1
MGNNCCAGRDLLYKNKLQEFGIEGSKTIRKLLSFTSNDILRFDKAYDENDVQEFVNLCSS
TCEIEKLEDRMHPWAADPKTIGALSATQLAILASKENEPHYKDAIREANGIAVFINLLKS
HELDRVHAAVVALSFLSVDNVKNCICMFESGALPYLISGMKSNIDGMKAACAQTCRNIFV
LDKKYKKEFLKLGGITQLVNLLELPSNYDDSQPLYTQLEAIYHLEDFILNDGDEIPEFLE
AVKNSNSIKNLKTLQQCPEQDLAEASNVLLLRLTD

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 987533342247765677641000466677630457870125665302672999875025
Pred: CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHCCCCHHHHHHHHCC
  AA: MGNNCCAGRDLLYKNKLQEFGIEGSKTIRKLLSFTSNDILRFDKAYDENDVQEFVNLCSS
              10        20        30        40        50        60


Conf: 420344564206777892048589999999998055993379999970766989842079
Pred: CCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCHHHHHHHHCC
  AA: TCEIEKLEDRMHPWAADPKTIGALSATQLAILASKENEPHYKDAIREANGIAVFINLLKS
              70        80        90       100       110       120


Conf: 974799999999998420460245788717991688730158986799999999876610
Pred: CCHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHH
  AA: HELDRVHAAVVALSFLSVDNVKNCICMFESGALPYLISGMKSNIDGMKAACAQTCRNIFV
             130       140       150       160       170       180


Conf: 694749999982984879986279999899852687999999978875317999707899
Pred: CCHHHHHHHHHCCCHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHH
  AA: LDKKYKKEFLKLGGITQLVNLLELPSNYDDSQPLYTQLEAIYHLEDFILNDGDEIPEFLE
             190       200       210       220       230       240


Conf: 99848953889994439998999999999985109
Pred: HHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCC
  AA: AVKNSNSIKNLKTLQQCPEQDLAEASNVLLLRLTD
             250       260       270

Show Conservation Score by AL2CO

1     M      -1.000    *
2     G      -1.000    *
3     N      -1.000    *
4     N      -1.000    *
5     C      -1.000    *
6     C      -1.000    *
7     A      -1.000    *
8     G      -1.000    *
9     R      -1.000    *
10    D      -1.000    *
11    L      -1.000    *
12    L      -1.000    *
13    Y      -1.000    *
14    K      -1.000    *
15    N      -1.000    *
16    K      -1.000    *
17    L      -1.000    *
18    Q      -1.000    *
19    E      -1.000    *
20    F      -1.000    *
21    G      -1.000    *
22    I      -1.000    *
23    E      -1.000    *
24    G      -1.000    *
25    S      -1.000    *
26    K      -1.000    *
27    T      -1.000    *
28    I      -1.000    *
29    R      -1.000    *
30    K      -1.000    *
31    L      -1.000    *
32    L      -1.000    *
33    S      -1.000    *
34    F      -1.000    *
35    T      -1.000    *
36    S      -1.000    *
37    N      -1.000    *
38    D      -1.000    *
39    I      -1.000    *
40    L      -1.000    *
41    R      -1.000    *
42    F      -1.000    *
43    D      -1.000    *
44    K      -1.000    *
45    A      -1.000    *
46    Y      -1.000    *
47    D      -1.000    *
48    E      -1.000    *
49    N      -1.000    *
50    D      -1.000    *
51    V      -1.000    *
52    Q      -1.000    *
53    E      -1.000    *
54    F      -1.000    *
55    V      -1.000    *
56    N      -1.000    *
57    L      -1.000    *
58    C      -1.000    *
59    S      -1.000    *
60    S      -1.000    *
61    T      -1.000    *
62    C      -1.000    *
63    E      -1.000    *
64    I      -1.000    *
65    E      -1.000    *
66    K      -1.000    *
67    L      -1.000    *
68    E      -1.000    *
69    D      -1.000    *
70    R      -1.000    *
71    M      -1.000    *
72    H      -1.000    *
73    P      -1.000    *
74    W      -1.000    *
75    A      -1.000    *
76    A      -1.000    *
77    D      -1.000    *
78    P      -1.000    *
79    K      -1.000    *
80    T      -1.000    *
81    I      -1.000    *
82    G      -0.019
83    A      -0.281
84    L      -0.188
85    S       0.170
86    A      -0.458
87    T      -0.704
88    Q      -0.619
89    L       0.114
90    A       0.041
91    I      -0.871
92    L      -0.383
93    A       0.438
94    S      -0.220
95    K      -1.019
96    E      -0.236
97    N      -1.134
98    E      -0.646
99    P      -0.254
100   H      -1.056
101   Y      -0.794
102   K       0.185
103   D      -0.729
104   A      -1.144
105   I       1.608
106   R      -0.073
107   E      -1.151
108   A      -0.566
109   N       1.117
110   G       0.836
111   I       2.219
112   A      -0.166
113   V      -0.869
114   F       1.992
115   I       1.550
116   N      -0.696
117   L       1.919
118   L       3.120
119   K      -0.664
120   S      -0.411
121   H      -1.437
122   E      -0.132
123   L      -1.455
124   D      -1.091
125   R      -0.503
126   V      -0.501
127   H      -0.827
128   A      -0.699
129   A       0.969
130   V       0.647
131   V      -0.972
132   A       1.168
133   L       2.165
134   S      -0.224
135   F       0.063
136   L       1.272
137   S       0.914
138   V       0.054
139   D      -0.853
140   N       0.252
141   V      -0.619
142   K      -0.419
143   N       0.029
144   C      -0.472
145   I      -1.079
146   C      -0.725
147   M       1.089
148   F       0.053
149   E      -0.329
150   S      -0.891
151   G       0.776
152   A       1.393
153   L       1.039
154   P       0.607
155   Y      -0.956
156   L       1.903
157   I       1.949
158   S      -1.043
159   G       0.486
160   M       1.443
161   K      -0.487
162   S      -0.027
163   N      -0.392
164   I      -1.031
165   D      -1.039
166   G      -0.954
167   M       0.179
168   K       0.016
169   A      -0.716
170   A      -0.413
171   C       1.435
172   A       1.119
173   Q      -0.554
174   T       0.888
175   C       0.948
176   R       0.317
177   N       2.208
178   I       1.490
179   F       0.203
180   V      -0.630
181   L      -1.060
182   D       0.195
183   K      -1.165
184   K      -0.847
185   Y      -1.017
186   K       1.139
187   K      -1.069
188   E      -0.933
189   F       0.668
190   L      -0.025
191   K      -0.965
192   L      -0.825
193   G       2.011
194   G       1.584
195   I       1.896
196   T      -0.543
197   Q       0.053
198   L       1.887
199   V       1.438
200   N      -0.906
201   L       0.192
202   L       1.600
203   E      -0.495
204   L      -1.000    *
205   P      -1.000    *
206   S      -1.000    *
207   N      -1.000    *
208   Y      -1.000    *
209   D      -1.000    *
210   D      -1.000    *
211   S      -0.280
212   Q      -1.137
213   P      -1.022
214   L      -1.064
215   Y      -1.593
216   T      -0.728
217   Q      -0.339
218   L      -0.362
219   E      -0.310
220   A       0.398
221   I       0.057
222   Y      -1.084
223   H      -0.621
224   L       1.210
225   E      -0.754
226   D      -0.102
227   F       0.795
228   I       0.073
229   L      -0.817
230   N      -0.947
231   D      -0.572
232   G      -1.061
233   D      -0.254
234   E      -0.792
235   I      -0.578
236   P      -0.531
237   E      -0.263
238   F      -0.577
239   L      -0.617
240   E      -0.781
241   A      -0.646
242   V       1.699
243   K      -0.666
244   N      -0.787
245   S      -0.246
246   N       0.989
247   S       0.379
248   I       0.430
249   K      -0.504
250   N      -0.209
251   L       2.470
252   K      -0.526
253   T      -1.245
254   L       1.485
255   Q      -0.444
256   Q      -1.030
257   C       0.311
258   P      -0.650
259   E       1.092
260   Q      -1.115
261   D      -0.609
262   L       0.830
263   A      -0.704
264   E      -0.305
265   A      -0.752
266   S       1.837
267   N      -0.710
268   V      -0.480
269   L       0.410
270   L       0.885
271   L      -0.322
272   R       0.585
273   L       3.138
274   T       1.684
275   D      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 280.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MGNNCCAGRD LLYKNKLQEF GIEGSKTIRK LLSFTSNDIL RFDKAYDEND VQEFVNLCSS 
        70         80         90        100        110        120 TCEIEKLEDR MHPWAADPKT IGALSATQLA ILASKENEPH YKDAIREANG IAVFINLLKS 
       130        140        150        160        170        180 HELDRVHAAV VALSFLSVDN VKNCICMFES GALPYLISGM KSNIDGMKAA CAQTCRNIFV 
       190        200        210        220        230        240 LDKKYKKEFL KLGGITQLVN LLELPSNYDD SQPLYTQLEA IYHLEDFILN DGDEIPEFLE 
       250        260        270                                  AVKNSNSIKN LKTLQQCPEQ DLAEASNVLL LRLTD

5EWP (X-Ray,1.8 Å resolution)

PfARO is a novel protein with Armadillo repeats like beta-catenin. Mitra et al. found that PfARO is spatiotemporally regulated and can be found in both nucleus and the cytosol at the apical pole at different stages of development. LMB causes nuclear accumulation of PfARO at all stages. However, putative NES identified is within the ARM repeat (residues 198-204) and hydrophobic side chains are buried. No further validation of the putative NES has been performed.

[1]. "Evidence for the Nucleo-Apical Shuttling of a Beta-Catenin Like Plasmodium falciparum Armadillo Repeat Containing Protein"
Mitra P, Gupta ED, Sahar T, Pandey AK, Dangi P, Reddy KS, Chauhan VS, Gaur D. (2016) PLoS One, 11(2):e0148446 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©