NESdb

Summary for HPV11 E7 (NES ID: 290)

Full Name

HPV11 Protein E7 UniProt

Alternative Names

None

Organism

Human papillomavirus type 11

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1 ^{Ref.1Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7, McKee et al., Virology, 2013}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L79A, ⁸²LLL⁸⁴ mutated to A ^{Ref.1Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7, McKee et al., Virology, 2013}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>sp|P04020|VE7_HPV11 Protein E7 OS=Human papillomavirus type 11 OX=10580 GN=E7 PE=1 SV=1
MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCG
CDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988879927548342389998843125578998631122332247677797599944698
Pred: CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCC
  AA: MHGRLVTLKDIVLDLQPPDPVGLHCYEQLEDSSEDEVDKVDKQDAQPLTQHYQILTCCCG
              10        20        30        40        50        60


Conf: 89860899996512499999971048624587888999
Pred: CCCCEEEEEEECHHHHHHHHHHHCCCCCEECCCCCCCC
  AA: CDSNVRLVVECTDGDIRQLQDLLLGTLNIVCPICAPKP
              70        80        90

Show Conservation Score by AL2CO

1     M       2.848
2     H       0.097
3     G       2.848
4     R      -0.568
5     L      -0.878
6     V       0.298
7     T      -0.185
8     L       0.438
9     K      -0.507
10    D       1.044
11    I       0.916
12    V      -0.313
13    L       1.209
14    D      -0.428
15    L      -0.046
16    Q      -0.804
17    P      -0.115
18    P      -0.639
19    D      -0.617
20    P      -0.135
21    V      -0.586
22    G       0.104
23    L       2.191
24    H      -0.804
25    C       0.530
26    Y      -0.051
27    E       0.928
28    Q      -0.449
29    L      -0.119
30    E      -0.598
31    D      -0.360
32    S      -0.226
33    S      -0.528
34    E      -0.403
35    D      -0.389
36    E      -0.568
37    V      -0.741
38    D      -0.792
39    K      -0.780
40    V      -0.718
41    D      -0.821
42    K      -0.804
43    Q      -0.666
44    D      -0.660
45    A      -0.734
46    Q      -0.721
47    P      -0.470
48    L      -0.598
49    T      -0.761
50    Q      -0.819
51    H      -0.715
52    Y       1.300
53    Q      -0.487
54    I       1.526
55    L      -0.627
56    T       0.280
57    C      -1.142
58    C       2.533
59    C      -0.822
60    G      -1.079
61    C       2.848
62    D      -0.654
63    S      -0.698
64    N      -0.743
65    V       1.351
66    R       0.084
67    L       0.569
68    V      -0.349
69    V       0.689
70    E      -0.931
71    C       0.628
72    T      -0.275
73    D      -0.937
74    G      -0.888
75    D      -0.253
76    I       0.707
77    R      -0.593
78    Q      -0.905
79    L       0.625
80    Q       0.283
81    D      -0.752
82    L       0.505
83    L       1.479
84    L      -0.371
85    G      -0.488
86    T      -0.412
87    L       0.648
88    N      -0.863
89    I       0.995
90    V       0.487
91    C       2.848
92    P      -0.311
93    I      -0.958
94    C       2.848
95    A       0.458
96    P      -0.486
97    K      -1.000    *
98    P      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 290.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MHGRLVTLKD IVLDLQPPDP VGLHCYEQLE DSSEDEVDKV DKQDAQPLTQ HYQILTCCCG 
        70         80         90                                  
CDSNVRLVVE CTDGDIRQLQ DLLLGTLNIV CPICAPKP

3D Structures in PDB

Not Available

Comments

HPV E7 proteins are responsible for driving cell cycle reentry in host cells for viral replication. This entry is related to HPV16 E7 (#114) and HPV8 E7 (#298). Conserved in the other two E7 homologs, putative NES can be found in the Zinc finger domain spanning 76-84, which matches traditional consensus. The protein is RJA sensitive (similar to LMB) when the NLS is weakened by C58A/C91A mutations located also in the Zinc finger domain. CRM1 interaction with full length E7 and zinc-finger domain was shown using co-IP with cellular lysates.

References

[1]. "Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7"
McKee CH, Onder Z, Ashok A, Cardoso R, Moroianu J. (2013) Virology, 443(1):113-122 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©