NESdb

Summary for HPV8 E7 (NES ID: 298)

Full Name

HPV8 protein E7 UniProt

Alternative Names

None

Organism

Human papillomavirus type 8 (HPV-8)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1 ^{Ref.1Nuclear Export of Cutaneous HPV8 E7 Oncoprotein Is Mediated by a Leucine-Rich Nuclear Export Signal via a CRM1 Pathway, Onder et al., Virology, 2015}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

I76A, F79A, L82A ^{Ref.1Nuclear Export of Cutaneous HPV8 E7 Oncoprotein Is Mediated by a Leucine-Rich Nuclear Export Signal via a CRM1 Pathway, Onder et al., Virology, 2015}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>sp|P06430|VE7_HPV08 Protein E7 OS=Human papillomavirus type 8 OX=10579 GN=E7 PE=3 SV=1
MIGKEVTVQDFVLKLSEIQPEVLPVDLLCEEELPNEQETEEELDIERTVFKIVAPCGCSC
CQVKLRLFVNATDSGIRTFQELLFRDLQLLCPECRGNCKHGGS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988889926558713689998626652114779999531111100148401995106974
Pred: CCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCCEEEEEECCCC
  AA: MIGKEVTVQDFVLKLSEIQPEVLPVDLLCEEELPNEQETEEELDIERTVFKIVAPCGCSC
              10        20        30        40        50        60


Conf: 6998159999483458999996001750138232354556899
Pred: CCCCEEEEEEECHHHHHHHHHHHHCCCCEECCCCCCCCCCCCC
  AA: CQVKLRLFVNATDSGIRTFQELLFRDLQLLCPECRGNCKHGGS
              70        80        90       100

Show Conservation Score by AL2CO

1     M       3.187
2     I       0.070
3     G       2.825
4     K      -0.661
5     E      -0.948
6     V       0.233
7     T      -0.167
8     V       0.585
9     Q      -0.436
10    D       0.993
11    F       1.017
12    V      -0.335
13    L       1.972
14    K      -0.243
15    L      -0.174
16    S      -0.895
17    E      -0.312
18    I      -0.426
19    Q      -0.617
20    P      -0.496
21    E      -0.837
22    V      -0.142
23    L      -0.674
24    P       0.641
25    V      -0.465
26    D       0.273
27    L       1.520
28    L      -0.785
29    C       0.806
30    E       0.189
31    E       1.878
32    E      -0.326
33    L       0.015
34    P      -0.525
35    N      -0.613
36    E      -0.198
37    Q      -0.579
38    E      -0.414
39    T      -0.709
40    E      -0.619
41    E      -0.393
42    E      -0.709
43    L      -0.780
44    D      -0.866
45    I      -0.916
46    E      -0.610
47    R      -0.917
48    T      -1.047
49    V      -0.807
50    F       0.397
51    K      -0.655
52    I       0.700
53    V      -0.746
54    A       0.266
55    P      -0.996
56    C       1.562
57    G      -0.693
58    C      -1.000    *
59    S      -0.811
60    C      -1.122
61    C       2.833
62    Q      -0.688
63    V      -0.716
64    K      -0.704
65    L       1.368
66    R       0.067
67    L       0.659
68    F      -0.392
69    V       0.683
70    N      -0.975
71    A       0.905
72    T      -0.319
73    D      -0.997
74    S      -0.954
75    G      -0.138
76    I       0.842
77    R      -0.607
78    T      -0.953
79    F       0.586
80    Q       0.186
81    E      -0.790
82    L       0.505
83    L       1.468
84    F      -0.552
85    R      -0.512
86    D      -0.498
87    L       0.696
88    Q      -0.971
89    L       1.010
90    L       0.436
91    C       2.495
92    P      -0.219
93    E      -1.024
94    C       3.187
95    R       0.222
96    G      -0.812
97    N      -0.913
98    C      -0.680
99    K      -0.130
100   H       0.761
101   G       1.172
102   G      -1.000    *
103   S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 298.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MIGKEVTVQD FVLKLSEIQP EVLPVDLLCE EELPNEQETE EELDIERTVF KIVAPCGCSC 
        70         80         90        100                       
CQVKLRLFVN ATDSGIRTFQ ELLFRDLQLL CPECRGNCKH GGS

3D Structures in PDB

Not Available

Comments

HPV E7 proteins are responsible for driving cell cycle reentry in host cells for viral replication. This entry is related to HPV16 E7 (#114) and HPV11 E7 (#290). Conserved in the other two E7 homologs, putative NES can be found in the Zinc finger domain spanning 76-84, which matches traditional consensus. C-terminal of the protein (43-103) is RJA sensitive (similar to LMB) when the NLS is weakened by C60A/C91A mutations located also in the Zinc finger domain. CRM1 interaction with full length E7 and zinc-finger domain was shown using co-IP with cellular lysates.

References

[1]. "Nuclear Export of Cutaneous HPV8 E7 Oncoprotein Is Mediated by a Leucine-Rich Nuclear Export Signal via a CRM1 Pathway"
Onder Z, Chang V, Moroianu J. (2015) Virology, 474:28-33 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©