NESdb

Summary for DeSI1 (NES ID: 314)

Full Name

Desumoylating isopeptidase 1 UniProt

Alternative Names

Polyubiquitinated substrate transporter (POST), PPPDE peptidase domain-containing protein 2

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Binds CRM1 ^{Ref.1Nuclear Export of Ubiquitinated Proteins via the UBIN-POST System, Hirayama et al., Proc Natl Acad Sci U S A, 2018}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L144A/L147A/L148A/I151A/I153A ^{Ref.1Nuclear Export of Ubiquitinated Proteins via the UBIN-POST System, Hirayama et al., Proc Natl Acad Sci U S A, 2018}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

¹³⁹PFGQALRPLLDSIQI¹⁵³ ^{Ref.1Nuclear Export of Ubiquitinated Proteins via the UBIN-POST System, Hirayama et al., Proc Natl Acad Sci U S A, 2018}

Secondary Structure of Export Signal

alpha-helix

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>sp|Q6ICB0|DESI1_HUMAN Desumoylating isopeptidase 1 OS=Homo sapiens OX=9606 GN=DESI1 PE=1 SV=1
MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPP
GGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLT
GRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 999995026899724751489852901007502614542078708146762884234189
Pred: CCCCCCCCEEEEEEECCHHHHHHHCHHCCCCCCCEEEEEEEEECCEEEEECCCCEEEECC
  AA: MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPP
              10        20        30        40        50        60


Conf: 987689995487524654599999999962327898833335643478620599987643
Pred: CCCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHC
  AA: GGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLT
              70        80        90       100       110       120


Conf: 999992543390686579258877999998440799998899999999
Pred: CCCCCHHHHCCCHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
  AA: GRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS
             130       140       150       160

Show Conservation Score by AL2CO

1     M      -1.000    *
2     E      -1.000    *
3     P      -1.000    *
4     P      -1.000    *
5     N      -1.000    *
6     L      -1.000    *
7     Y      -1.000    *
8     P      -0.687
9     V       2.173
10    K      -1.040
11    L       1.332
12    Y      -0.333
13    V       0.273
14    Y       2.355
15    D       2.451
16    L       0.793
17    S       1.509
18    K      -0.247
19    G       2.204
20    L       0.248
21    A       0.652
22    R      -0.257
23    R      -0.712
24    L       0.067
25    S       0.494
26    P      -1.066
27    I      -0.843
28    M      -0.065
29    L       0.269
30    G       0.729
31    K      -0.694
32    Q      -1.026
33    L       0.477
34    E       0.387
35    G       1.004
36    I       0.894
37    W       1.076
38    H       1.970
39    T       1.876
40    S       0.735
41    I       0.732
42    V      -0.789
43    V      -0.120
44    H      -0.502
45    K       0.171
46    D      -0.904
47    E       2.541
48    F      -0.049
49    F       0.020
50    F       1.118
51    G       0.018
52    S      -0.715
53    G      -0.604
54    G       0.687
55    I      -0.498
56    S      -1.187
57    S      -1.131
58    C      -1.198
59    P      -1.170
60    P      -0.479
61    G      -0.555
62    G      -1.035
63    T      -0.377
64    L      -1.104
65    L      -0.627
66    G      -0.009
67    P      -0.991
68    P       1.050
69    D      -1.090
70    S      -0.398
71    V      -0.255
72    V      -0.612
73    D      -1.059
74    V       0.711
75    G       1.980
76    S      -1.029
77    T       2.128
78    E      -1.001
79    V      -0.150
80    T      -0.301
81    E      -1.199
82    E      -0.742
83    I      -0.539
84    F       0.175
85    L      -1.266
86    E      -0.548
87    Y       0.322
88    L       0.287
89    S      -1.109
90    S      -0.432
91    L       0.038
92    G      -0.541
93    E      -0.845
94    S      -1.001
95    L      -1.061
96    F       1.112
97    R      -0.314
98    G      -0.936
99    E      -0.786
100   A      -0.590
101   Y       1.521
102   N       0.063
103   L       0.640
104   F       0.375
105   E      -0.889
106   H      -0.048
107   N       2.846
108   C       2.464
109   N       2.464
110   T       0.344
111   F       2.011
112   S       1.551
113   N       0.066
114   E      -0.212
115   V      -0.034
116   A       0.032
117   Q      -0.998
118   F       0.585
119   L       1.495
120   T       0.006
121   G       0.292
122   R      -0.716
123   K      -0.697
124   I       1.461
125   P       1.256
126   S      -0.614
127   Y      -0.127
128   I       2.015
129   T      -0.321
130   D      -0.590
131   L       0.668
132   P       0.653
133   S      -0.736
134   E      -0.598
135   V       0.733
136   L      -0.320
137   S      -0.396
138   T       0.849
139   P      -0.032
140   F      -0.397
141   G       1.092
142   Q      -0.651
143   A      -0.525
144   L       0.408
145   R      -0.699
146   P      -0.376
147   L      -0.715
148   L       0.218
149   D      -0.291
150   S      -0.845
151   I      -0.633
152   Q      -1.113
153   I      -1.250
154   Q      -0.896
155   P      -0.841
156   P      -0.909
157   G      -0.799
158   G      -0.695
159   S      -1.056
160   S      -1.097
161   V      -1.046
162   G      -0.786
163   R      -0.983
164   P      -0.418
165   N      -1.000    *
166   G      -1.000    *
167   Q      -1.000    *
168   S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 314.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MEPPNLYPVK LYVYDLSKGL ARRLSPIMLG KQLEGIWHTS IVVHKDEFFF GSGGISSCPP 
        70         80         90        100        110        120 GGTLLGPPDS VVDVGSTEVT EEIFLEYLSS LGESLFRGEA YNLFEHNCNT FSNEVAQFLT 
       130        140        150        160                       
GRKIPSYITD LPSEVLSTPF GQALRPLLDS IQIQPPGGSS VGRPNGQS

3D Structures in PDB

3EBQ (X-Ray,1.9 Å resolution)

Comments

DeSI1 (or POST) is a small protein that interacts with UBQLN4 (or UBIN). Hirayama et al. found that UBIN-POST are exported in a LMB-sensitive manner by the action of an NES within POST. The NES identified is sufficient to direct nuclear exit of Venus fusions and binds CRM1 in vitro in a Ran-dependent manner. Mutations to the NES in the full-length protein caused increase nuclear accumulation. This study showed that CRM1 binds to POST which binds to UBIN, and UBIN in turn recognizes K48-linked polyubiquitinated proteins for nuclear export. The NES is located at the C-terminus of the protein and appears exposed and accessible for CRM1 binding in X-ray structure.

References

[1]. "Nuclear Export of Ubiquitinated Proteins via the UBIN-POST System"
Hirayama S, Sugihara M, Morito D, Iemura SI, Natsume T, Murata S, Nagata K. (2018) Proc Natl Acad Sci U S A, 115(18):E4199-E4208 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©