NESdb

Summary for pUL11 (NES ID: 329)

Full Name

Cytoplasmic envelopment protein 3 UniProt

Alternative Names

CEP3

Organism

Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Comprehensive analysis of nuclear export of herpes simplex virus type 1 tegument proteins and their Epstein-Barr virus orthologs, Funk et al., Traffic, 2019}

Mutations That Affect Nuclear Export

Unknown

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>sp|P04289|CEP3_HHV11 Cytoplasmic envelopment protein 3 OS=Human herpesvirus 1 (strain 17) OX=10299 GN=UL11 PE=1 SV=3
MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPG
RQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 987778984531016359736994788731454033310247764230899512231899
Pred: CCCCCCCCCCCCCCCCEEECCCCCEEEEECCCCEEEEECCCCCCCEECCCCCCEEECCCC
  AA: MGLSFSGARPCCCRNNVLITDDGEVVSLTAHDFDVVDIESEEEGNFYVPPDMRGVTRAPG
              10        20        30        40        50        60


Conf: 888899999999875469998899722899999899
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: RQRLRSSDPPSRHTHRRTPGGACPATQFPPPMSDSE
              70        80        90

Show Conservation Score by AL2CO

1     M       1.452
2     G       1.452
3     L       1.452
4     S      -0.601
5     F      -1.222
6     S       1.452
7     G      -1.222
8     A      -1.186
9     R      -0.636
10    P      -1.153
11    C       0.122
12    C       1.452
13    C       0.196
14    R       0.196
15    N      -0.636
16    N       0.196
17    V       0.196
18    L       0.118
19    I       0.141
20    T       1.452
21    D       0.208
22    D      -2.025
23    G       1.452
24    E       1.452
25    V      -0.631
26    V       1.452
27    S       0.122
28    L       1.452
29    T       1.452
30    A       1.452
31    H      -1.659
32    D       0.244
33    F       1.452
34    D       1.452
35    V      -0.677
36    V       1.452
37    D       0.144
38    I       0.144
39    E       0.106
40    S       0.196
41    E       0.114
42    E      -0.677
43    E       0.114
44    G       0.196
45    N       1.452
46    F       1.452
47    Y       1.452
48    V      -0.658
49    P       0.114
50    P       0.196
51    D      -0.653
52    M       0.141
53    R       0.196
54    G      -0.601
55    V       0.122
56    T       0.196
57    R      -1.222
58    A      -1.216
59    P      -0.604
60    G      -1.636
61    R      -0.674
62    Q       0.149
63    R      -1.204
64    L      -1.184
65    R      -1.165
66    S      -1.984
67    S      -0.613
68    D      -0.647
69    P       1.452
70    P       0.211
71    S       1.452
72    R       0.211
73    H      -1.231
74    T      -0.636
75    H      -0.597
76    R       0.106
77    R       0.106
78    T      -1.226
79    P      -0.676
80    G      -1.226
81    G       0.162
82    A       0.112
83    C      -0.630
84    P       1.452
85    A      -1.206
86    T      -0.679
87    Q      -1.238
88    F      -1.238
89    P       0.146
90    P       0.112
91    P       1.452
92    M      -1.000    *
93    S      -1.000    *
94    D      -1.000    *
95    S      -1.000    *
96    E      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 329.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MGLSFSGARP CCCRNNVLIT DDGEVVSLTA HDFDVVDIES EEEGNFYVPP DMRGVTRAPG 
        70         80         90                                  RQRLRSSDPP SRHTHRRTPG GACPATQFPP PMSDSE

3D Structures in PDB

Not Available

Comments

pUL11 is a virion membrane-associated tegument protein. Funk et al. found this protein to have nucear export activity using Nuclear EXport Trapped by RAPamycin (NEX-TRAP). EBV homolog pBBLF1 was shown to have both nuclear and cytoplasmic localization, but nuclear export activity was unable to be determined using the same assay.

References

[1]. "Comprehensive analysis of nuclear export of herpes simplex virus type 1 tegument proteins and their Epstein-Barr virus orthologs"
Funk C, Raschbichler V, Lieber D, Wetschky J, Arnold EK, Leimser J, Biggel M, Friedel CC, Ruzsics Z, Bailer SM. (2019) Traffic, 20:152-167 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©