NESdb

Hypoxia-inducible factor 1-alpha inhibitor UniProt

Factor inhibiting HIF-1, Hypoxia-inducible factor asparagine hydroxylase

Homo sapiens (Human)

LMB Sensitive, Binds CRM1 ^{Ref.1Nuclear Entry and Export of FIH Are Mediated by HIF1α and exportin1, Respectively, Wang et al., J Cell Sci, 2018}

*highlighted yellow in the full sequence

¹²⁸FVEKLQDIQQ¹³⁷ by Deletion ^{Ref.1Nuclear Entry and Export of FIH Are Mediated by HIF1α and exportin1, Respectively, Wang et al., J Cell Sci, 2018}

*shown as red residues in the full sequence

¹²⁸FVEKLQDIQQ¹³⁷ by Deletion ^{Ref.1Nuclear Entry and Export of FIH Are Mediated by HIF1α and exportin1, Respectively, Wang et al., J Cell Sci, 2018}

Undetermined

alpha-helix

Unknown

Show FASTA Format

>sp|Q9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2
MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE
PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR
EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG
QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS
QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 946468787559999942125899998800124599999533567899954998510799
Pred: CHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCC
  AA: MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEE
              10        20        30        40        50        60


Conf: 979985788565679999899874199435996438776434402221013689987763
Pred: CEEEECCCCCCCCCCCCHHHHHHHCCCCEEEEEECCCCCCCCCHHHHHCCCCCCCCCCCC
  AA: PVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNR
              70        80        90       100       110       120


Conf: 210199999999866504998416763233200113331165888943121001577888
Pred: CCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCC
  AA: EEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWG
             130       140       150       160       170       180


Conf: 764213644079997843456688543898234589970999989978879889999866
Pred: CCCCCEEEEECCCCCCCCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCC
  AA: QLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQS
             190       200       210       220       230       240


Conf: 468999996479898898123899779956564499816678741898079998530489
Pred: CCCCCCCCCCCCCCCCCCCEEEEEECCCCEEEECCCCEEEEEEECCCCEEEEEEEEECCC
  AA: QVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGA
             250       260       270       280       290       300


Conf: 9986645325553144665527999998826995130689988504589
Pred: CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCCC
  AA: PTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
             310       320       330       340

Show Conservation Score by AL2CO

1     M      -1.000    *
2     A      -1.000    *
3     A      -1.000    *
4     T      -1.000    *
5     A      -1.000    *
6     A      -1.000    *
7     E      -1.000    *
8     A      -1.000    *
9     V      -1.000    *
10    A      -1.000    *
11    S      -1.000    *
12    G      -1.000    *
13    S      -1.000    *
14    G      -1.000    *
15    E      -1.000    *
16    P      -1.000    *
17    R      -1.000    *
18    E      -1.000    *
19    E      -1.000    *
20    A      -1.000    *
21    G      -1.000    *
22    A      -1.000    *
23    L      -1.000    *
24    G      -1.000    *
25    P      -1.000    *
26    A      -1.000    *
27    W      -1.000    *
28    D      -1.000    *
29    E      -1.000    *
30    S      -1.000    *
31    Q      -1.000    *
32    L      -1.000    *
33    R      -1.000    *
34    S      -1.000    *
35    Y      -1.000    *
36    S      -1.000    *
37    F      -0.548
38    P      -0.430
39    T      -0.760
40    R      -0.644
41    P      -0.570
42    I       0.780
43    P      -0.197
44    R      -0.363
45    L      -0.090
46    S      -0.543
47    Q      -1.002
48    S      -0.916
49    D       0.020
50    P      -0.807
51    R      -0.302
52    A      -0.854
53    E      -0.498
54    E      -0.741
55    L       0.200
56    I       0.064
57    E      -0.923
58    N      -0.630
59    E      -0.290
60    E      -0.489
61    P       3.777
62    V       0.895
63    V       1.611
64    L       1.354
65    T      -0.399
66    D       0.019
67    T      -0.581
68    N      -0.645
69    L      -0.740
70    V      -0.485
71    Y      -0.499
72    P      -0.053
73    A       0.642
74    L      -0.728
75    K       0.156
76    W       3.388
77    D       0.478
78    L      -0.212
79    E      -0.214
80    Y       1.821
81    L       1.355
82    Q      -0.696
83    E      -0.339
84    N      -0.385
85    I      -0.128
86    G       0.118
87    N      -0.841
88    G      -0.591
89    D      -0.634
90    F       0.838
91    S      -0.192
92    V       1.176
93    Y      -0.267
94    S      -0.564
95    A       0.780
96    S      -0.482
97    T      -0.422
98    H      -1.000    *
99    K      -1.000    *
100   F      -1.000    *
101   L      -1.000    *
102   Y       0.004
103   Y      -0.480
104   D      -0.157
105   E      -0.593
106   K      -0.467
107   K      -0.334
108   M      -0.663
109   A      -0.899
110   N      -0.877
111   F      -0.970
112   Q      -0.697
113   N      -0.566
114   F       0.051
115   K      -0.662
116   P      -0.646
117   R      -0.881
118   S      -0.618
119   N      -0.788
120   R      -0.229
121   E      -0.706
122   E      -0.616
123   M      -0.555
124   K      -0.573
125   F      -0.051
126   H      -0.750
127   E      -0.349
128   F      -0.181
129   V      -0.274
130   E      -0.432
131   K      -0.969
132   L      -0.789
133   Q      -0.837
134   D      -0.904
135   I      -1.081
136   Q      -1.016
137   Q      -0.940
138   R      -1.048
139   G      -0.788
140   G      -0.725
141   E      -0.500
142   E      -1.034
143   R      -0.787
144   L      -0.369
145   Y       0.910
146   L       0.216
147   Q      -0.102
148   Q       0.003
149   T      -0.892
150   L      -0.135
151   N      -0.519
152   D      -0.629
153   T      -0.817
154   V      -0.790
155   G      -0.881
156   R      -0.576
157   K      -0.548
158   I      -0.633
159   V      -0.743
160   M      -1.063
161   D      -0.197
162   F      -0.118
163   L      -0.913
164   G      -1.076
165   F      -0.427
166   N      -0.596
167   W      -0.786
168   N      -0.742
169   W      -0.673
170   I      -0.592
171   N      -1.001
172   K      -0.564
173   Q      -0.865
174   Q      -0.822
175   G      -1.084
176   K      -1.097
177   R      -1.047
178   G      -0.849
179   W      -0.923
180   G      -0.272
181   Q      -0.574
182   L      -0.786
183   T      -0.752
184   S      -0.235
185   N       0.114
186   L       0.184
187   L       0.979
188   L       1.014
189   I       0.816
190   G       1.268
191   M      -0.221
192   E      -0.672
193   G      -0.186
194   N       0.670
195   V      -0.275
196   T       1.352
197   P       0.580
198   A       0.405
199   H       3.333
200   Y       0.415
201   D       3.333
202   E      -0.205
203   Q      -0.460
204   Q       0.002
205   N       1.684
206   F       0.935
207   F       0.772
208   A       0.150
209   Q       0.609
210   I       1.318
211   K      -0.853
212   G       3.777
213   Y      -0.665
214   K       3.328
215   R      -0.084
216   C       0.790
217   I      -0.184
218   L       2.546
219   F       0.506
220   P       0.032
221   P       0.357
222   D      -0.313
223   Q      -0.628
224   F      -0.250
225   E      -0.616
226   C      -0.759
227   L       1.131
228   Y       1.735
229   P       0.239
230   Y      -0.265
231   P       0.057
232   V      -0.315
233   H      -1.000    *
234   H      -0.735
235   P      -0.190
236   C      -0.263
237   D      -0.786
238   R      -0.345
239   Q      -0.264
240   S       0.220
241   Q      -0.596
242   V       0.299
243   D       0.676
244   F       0.271
245   D      -0.557
246   N      -0.475
247   P       1.255
248   D       2.040
249   Y      -0.481
250   E      -0.541
251   R      -0.512
252   F       1.661
253   P       2.994
254   N      -0.173
255   F       0.694
256   Q      -0.937
257   N      -0.651
258   V       0.815
259   V      -0.946
260   G      -0.463
261   Y      -0.506
262   E      -0.716
263   T       0.220
264   V      -0.637
265   V       2.007
266   G      -0.480
267   P       0.646
268   G       2.421
269   D       1.508
270   V       0.559
271   L       2.664
272   Y       1.932
273   I       1.620
274   P       3.364
275   M      -0.230
276   Y      -0.104
277   W       1.490
278   W       2.312
279   H       3.777
280   H       0.262
281   I       1.051
282   E      -0.539
283   S       1.374
284   L       0.718
285   L      -0.724
286   N      -0.352
287   G      -0.207
288   G      -0.299
289   I      -0.216
290   T       0.992
291   I       0.899
292   T       1.334
293   V       1.578
294   N       1.441
295   F       0.849
296   W       2.417
297   Y       0.986
298   K       0.105
299   G      -1.000    *
300   A      -1.000    *
301   P      -0.746
302   T      -0.767
303   P      -0.628
304   K      -0.703
305   R      -0.825
306   I      -0.392
307   E      -0.714
308   Y      -0.464
309   P       0.109
310   L      -0.688
311   K      -0.591
312   A      -0.057
313   H      -0.845
314   Q      -0.094
315   K      -0.379
316   V       0.044
317   A      -0.146
318   I       0.111
319   M      -0.051
320   R       0.440
321   N      -0.658
322   I       0.010
323   E       0.414
324   K      -0.376
325   M      -0.571
326   L       0.466
327   G      -0.674
328   E      -0.289
329   A      -0.295
330   L      -0.488
331   G      -1.000    *
332   N      -1.000    *
333   P      -1.000    *
334   Q      -1.000    *
335   E      -1.000    *
336   V      -1.000    *
337   G      -1.000    *
338   P      -1.000    *
339   L      -1.000    *
340   L      -1.000    *
341   N      -1.000    *
342   T      -1.000    *
343   M      -1.000    *
344   I      -1.000    *
345   K      -1.000    *
346   G      -1.000    *
347   R      -1.000    *
348   Y      -1.000    *
349   N      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 335.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MAATAAEAVA SGSGEPREEA GALGPAWDES QLRSYSFPTR PIPRLSQSDP RAEELIENEE 
        70         80         90        100        110        120 
PVVLTDTNLV YPALKWDLEY LQENIGNGDF SVYSASTHKF LYYDEKKMAN FQNFKPRSNR 
       130        140        150        160        170        180 
EEMKFHEFVE KLQDIQQRGG EERLYLQQTL NDTVGRKIVM DFLGFNWNWI NKQQGKRGWG 
       190        200        210        220        230        240 QLTSNLLLIG MEGNVTPAHY DEQQNFFAQI KGYKRCILFP PDQFECLYPY PVHHPCDRQS 
       250        260        270        280        290        300 QVDFDNPDYE RFPNFQNVVG YETVVGPGDV LYIPMYWWHH IESLLNGGIT ITVNFWYKGA 
       310        320        330        340                       PTPKRIEYPL KAHQKVAIMR NIEKMLGEAL GNPQEVGPLL NTMIKGRYN

1H2K (X-Ray,2.15 Å resolution)

FIH is s an asparaginyl hydroxylase that negatively regulates transcriptional activation by hypoxia inducible transcription factors (HIF). It is normally found in the cytoplasm, accumulates in the nucleus under hypoxia and can be re-exported when re-oxygenated. Wang et al. found that nuclear exit of FIH is sensitive to LMB, and FIH was found to interact with CRM1 in co-IP. Deletion of the putative NES in 128-137 both abolished export activity and CRM1 interaction. This region is however an alpha-helix within a large domain, while it is located on the outer surface, the hydrophobic side chains are not exposed.

[1]. "Nuclear Entry and Export of FIH Are Mediated by HIF1α and exportin1, Respectively"
Wang Y, Zhong S, Schofield CJ, Ratcliffe PJ, Lu X. (2018) J Cell Sci, 131(22):jcs219782 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©