NESdb

UBX domain-containing protein 2A UniProt

UBX domain-containing protein 4 (UBXD4)

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Nucleocytoplasmic Translocation of UBXN2A Is Required for Apoptosis During DNA Damage Stresses in Colon Cancer Cells, Abdullah et al., J Cancer, 2015}

Unknown

Undetermined

Unknown

Show FASTA Format

>sp|P68543|UBX2A_HUMAN UBX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=UBXN2A PE=1 SV=1
MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQ
VDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKN
EICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWL
ANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEADLQN
AVIIQRLQKTASFRELSEH

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 953200011000130016999999999988876545676200000004720488545751
Pred: CCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCC
  AA: MKDVDNLKSIKEEWVCETGSDNQPLGNNQQSNCEYFVDSLFEEAQKVSSKCVSPAEQKKQ
              10        20        30        40        50        60


Conf: 189998225785237987468982119999972219881545313587067886101567
Pred: EEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCHHHHCCCCCEEEEEECCCCCC
  AA: VDVNIKLWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPSELQGIFDKEEVDVKVEDKKN
              70        80        90       100       110       120


Conf: 743589999778866886558889863246887455411688885688999821069990
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCEEEEEE
  AA: EICLSTKPVFQPFSGQGHRLGSATPKIVSKAKNIEVENKNNLSAVPLNNLEPITNIQIWL
             130       140       150       160       170       180


Conf: 378625785048753217999999734898999908850799830258566832216654
Pred: CCCCEEEEEECCCCCHHHHHHHHHHHCCCCCCCCEEEECCCCCCCCCCCCCCHHHHCCCC
  AA: ANGKRIVQKFNITHRVSHIKDFIEKYQGSQRSPPFSLATALPVLRLLDETLTLEEADLQN
             190       200       210       220       230       240


Conf: 1232102567775213379
Pred: CEEEEECCCCCCCCCCCCC
  AA: AVIIQRLQKTASFRELSEH
             250

Show Conservation Score by AL2CO

1     M      -1.000    *
2     K      -1.000    *
3     D      -1.000    *
4     V      -1.000    *
5     D       1.363
6     N      -0.345
7     L       0.090
8     K       0.215
9     S      -0.504
10    I      -0.422
11    K       0.290
12    E      -0.042
13    E      -0.651
14    W      -0.783
15    V      -0.795
16    C      -0.902
17    E      -0.900
18    T      -1.010
19    G      -0.727
20    S      -0.835
21    D      -0.928
22    N      -0.817
23    Q      -0.787
24    P      -0.786
25    L      -1.119
26    G      -0.800
27    N      -1.054
28    N      -1.067
29    Q      -1.067
30    Q      -0.619
31    S      -0.923
32    N      -0.379
33    C      -0.757
34    E      -0.454
35    Y      -1.007
36    F      -0.310
37    V      -0.323
38    D       0.243
39    S      -0.782
40    L      -0.410
41    F      -0.871
42    E      -0.563
43    E      -0.404
44    A      -0.376
45    Q      -0.696
46    K      -1.079
47    V      -0.818
48    S      -0.853
49    S      -0.402
50    K      -0.882
51    C      -1.224
52    V      -1.034
53    S      -0.794
54    P      -0.873
55    A      -0.715
56    E      -0.744
57    Q      -0.859
58    K      -0.843
59    K      -0.787
60    Q      -0.894
61    V      -0.698
62    D      -0.877
63    V      -0.038
64    N      -0.825
65    I       1.371
66    K      -0.215
67    L       1.163
68    W       1.876
69    K      -0.088
70    N       0.570
71    G       2.887
72    F       1.988
73    T       1.238
74    V       1.637
75    N       0.967
76    D       0.714
77    D       1.184
78    F       1.305
79    R       0.508
80    S      -0.638
81    Y       0.665
82    S       0.042
83    D       0.278
84    G       0.607
85    A      -0.571
86    S       0.775
87    Q      -0.196
88    Q      -0.917
89    F      -0.100
90    L       1.604
91    N      -0.389
92    S      -0.619
93    I       1.189
94    K      -0.478
95    K      -0.290
96    G       1.454
97    E      -0.372
98    L       0.066
99    P       2.497
100   S      -0.994
101   E      -0.112
102   L       0.652
103   Q      -0.471
104   G      -0.371
105   I      -0.618
106   F      -1.006
107   D      -1.043
108   K      -0.045
109   E      -0.716
110   E      -0.932
111   V       0.812
112   D      -0.443
113   V       0.676
114   K      -0.630
115   V       1.286
116   E      -0.810
117   D      -0.157
118   K       0.183
119   K      -0.712
120   N      -0.485
121   E       0.198
122   I      -1.030
123   C      -0.203
124   L      -0.770
125   S      -0.137
126   T      -0.432
127   K      -0.456
128   P      -0.760
129   V      -0.754
130   F      -1.111
131   Q      -0.854
132   P      -0.174
133   F       3.366
134   S      -0.449
135   G       2.836
136   Q      -0.753
137   G       1.738
138   H      -0.136
139   R      -0.061
140   L       2.403
141   G       1.088
142   S      -0.022
143   A      -0.474
144   T      -0.330
145   P      -0.163
146   K      -0.859
147   I      -0.686
148   V      -0.766
149   S      -0.913
150   K      -0.927
151   A      -0.468
152   K      -0.751
153   N      -0.650
154   I      -1.015
155   E      -0.906
156   V      -0.861
157   E      -0.676
158   N      -0.918
159   K      -0.604
160   N      -0.913
161   N      -0.933
162   L      -1.027
163   S      -1.056
164   A      -1.090
165   V      -0.556
166   P      -0.713
167   L       0.487
168   N       0.901
169   N      -0.573
170   L      -0.392
171   E      -0.520
172   P       1.823
173   I      -0.376
174   T       0.947
175   N      -0.422
176   I       1.439
177   Q       1.523
178   I       1.627
179   W       1.459
180   L       1.446
181   A       0.090
182   N       1.613
183   G       2.932
184   K       0.041
185   R       0.947
186   I       0.324
187   V      -0.132
188   Q      -0.468
189   K       0.245
190   F       0.854
191   N       2.572
192   I      -0.499
193   T      -0.417
194   H       1.108
195   R       0.630
196   V       1.765
197   S      -0.615
198   H       0.112
199   I       1.719
200   K       0.803
201   D      -0.432
202   F       1.121
203   I       1.518
204   E      -0.711
205   K      -0.564
206   Y      -0.317
207   Q      -0.553
208   G      -0.192
209   S      -0.806
210   Q      -0.995
211   R      -0.854
212   S      -1.056
213   P      -0.743
214   P      -0.596
215   F       0.696
216   S      -0.832
217   L       1.527
218   A      -0.321
219   T       0.690
220   A      -0.024
221   L       1.385
222   P       3.745
223   V      -0.585
224   L       0.068
225   R      -0.466
226   L       1.372
227   L      -0.739
228   D       1.047
229   E      -1.034
230   T      -0.311
231   L      -0.294
232   T       0.641
233   L       1.888
234   E       0.214
235   E       0.077
236   A       0.451
237   D      -0.027
238   L       1.032
239   Q      -0.599
240   N       1.538
241   A       1.314
242   V       1.142
243   I       1.450
244   I       0.810
245   Q       1.409
246   R       1.787
247   L       0.341
248   Q      -1.000    *
249   K      -1.000    *
250   T      -1.000    *
251   A      -1.000    *
252   S      -1.000    *
253   F      -1.000    *
254   R      -1.000    *
255   E      -1.000    *
256   L      -1.000    *
257   S      -1.000    *
258   E      -1.000    *
259   H      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 336.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MKDVDNLKSI KEEWVCETGS DNQPLGNNQQ SNCEYFVDSL FEEAQKVSSK CVSPAEQKKQ 
        70         80         90        100        110        120 VDVNIKLWKN GFTVNDDFRS YSDGASQQFL NSIKKGELPS ELQGIFDKEE VDVKVEDKKN 
       130        140        150        160        170        180 EICLSTKPVF QPFSGQGHRL GSATPKIVSK AKNIEVENKN NLSAVPLNNL EPITNIQIWL 
       190        200        210        220        230        240 ANGKRIVQKF NITHRVSHIK DFIEKYQGSQ RSPPFSLATA LPVLRLLDET LTLEEADLQN 
       250                                                        AVIIQRLQKT ASFRELSEH

Not Available

UBXN2A is an activator of the p53 tumor suppressor protein. It is normally localized to the nucleus, but exposure to UV B radiation or the genotoxic agent Etoposide causes nuclear exit. LMB can cause accumulation of this protein in the nucleus under Etoposide induction, demonstrating CRM1 dependence of UBXN2A's nuclear exit upon DNA damage. Putative NES was identified in 224-233, however it is within the UBX domain and have not been further validated.

[1]. "Nucleocytoplasmic Translocation of UBXN2A Is Required for Apoptosis During DNA Damage Stresses in Colon Cancer Cells"
Abdullah A, Sane S, Freeling JL, Wang H, Zhang D, Rezvani K. (2015) J Cancer, 6(11):1066-78 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©