NESdb

Sigma non-opioid intracellular receptor 1 UniProt

Aging-associated gene 8 protein, SR31747-binding protein (SR-BP), Sigma 1-type opioid receptor (SIG-1R)

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Accumulation of the sigma-1 Receptor Is Common to Neuronal Nuclear Inclusions in Various Neurodegenerative Diseases, Miki et al., Neuropathology, 2014}

Unknown

Undetermined

Unknown

Show FASTA Format

>sp|Q99720|SGMR1_HUMAN Sigma non-opioid intracellular receptor 1 OS=Homo sapiens OX=9606 GN=SIGMAR1 PE=1 SV=1
MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 952004589999999999999999988871687534286899999999831696999999
Pred: CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEECHHHHHHHHHHHHCCCHHHHHHH
  AA: MQWAVGRRWAWAALLLAVAAVLTQVVWLWLGTQSFVFQREEIAQLARQYAGLDHELAFSR
              10        20        30        40        50        60


Conf: 999998748998889999871896067532102432101012222313324788887642
Pred: HHHHHHHHCCCCCCCCCCCCEEEEECCCCCCCHHHHHCCCHHHHHHHCCCCCCCCCCCCC
  AA: LIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCLLHASLSEYVLLFGTALGSRGHSGRY
              70        80        90       100       110       120


Conf: 132022887557998638994216632895146177434788647993899826676762
Pred: CCCCEEEEEEEEEEEEECCCCCEEEECCCCEEEECCCCEEEEEECCCEEEEEECCCCCCC
  AA: WAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPS
             130       140       150       160       170       180


Conf: 1146544343024446799999999999999999862208999
Pred: CCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCC
  AA: TLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP
             190       200       210       220

Show Conservation Score by AL2CO

1     M      -1.000    *
2     Q      -1.000    *
3     W      -1.000    *
4     A      -1.000    *
5     V      -1.000    *
6     G      -1.000    *
7     R      -1.000    *
8     R      -1.000    *
9     W      -0.312
10    A      -0.652
11    W      -0.554
12    A      -0.192
13    A      -0.561
14    L       0.025
15    L       0.408
16    L      -0.374
17    A      -0.481
18    V       0.107
19    A      -0.623
20    A      -0.834
21    V      -0.608
22    L      -0.033
23    T      -1.113
24    Q      -1.343
25    V      -0.501
26    V      -0.784
27    W      -1.270
28    L      -1.084
29    W      -1.213
30    L      -0.802
31    G      -1.073
32    T      -0.896
33    Q      -0.468
34    S      -0.988
35    F       0.182
36    V      -0.389
37    F       1.029
38    Q      -0.147
39    R      -0.746
40    E      -0.817
41    E      -1.266
42    I       0.879
43    A      -0.759
44    Q      -0.533
45    L       0.158
46    A       0.856
47    R      -0.206
48    Q      -0.405
49    Y      -0.657
50    A      -1.148
51    G      -0.702
52    L      -1.044
53    D       0.149
54    H      -0.992
55    E      -0.861
56    L      -0.977
57    A      -0.603
58    F       0.207
59    S      -0.869
60    R      -1.078
61    L       1.012
62    I      -0.847
63    V      -0.854
64    E      -0.600
65    L       1.344
66    R      -0.834
67    R      -0.715
68    L      -0.946
69    H      -0.506
70    P      -0.495
71    G      -0.723
72    H      -1.240
73    V      -0.528
74    L      -1.140
75    P      -1.168
76    D      -1.365
77    E      -1.106
78    E      -1.053
79    L      -1.152
80    Q      -0.986
81    W       2.634
82    V      -0.220
83    F      -0.379
84    V       0.455
85    N      -0.509
86    A      -0.499
87    G       2.118
88    G       0.558
89    W       0.427
90    M       0.053
91    G       0.175
92    A       0.077
93    M       0.049
94    C      -0.964
95    L       0.008
96    L       0.910
97    H       1.516
98    A      -0.591
99    S       0.272
100   L      -0.079
101   S       0.671
102   E       3.086
103   Y       1.380
104   V       1.330
105   L      -0.124
106   L       1.201
107   F       0.862
108   G       1.097
109   T       0.528
110   A       0.994
111   L       0.277
112   G      -0.198
113   S       1.853
114   R      -0.133
115   G       2.372
116   H      -0.350
117   S       0.332
118   G       0.634
119   R      -0.466
120   Y       0.407
121   W      -0.409
122   A       0.834
123   E      -0.046
124   I       0.036
125   S       0.632
126   D      -0.030
127   T      -0.180
128   I       1.238
129   I       1.951
130   S      -0.600
131   G       4.201
132   T      -0.571
133   F      -0.199
134   H      -0.842
135   Q      -0.479
136   W       0.132
137   R      -1.038
138   E       0.223
139   G      -0.377
140   T      -1.108
141   T      -0.838
142   K      -1.182
143   S      -1.043
144   E      -0.303
145   V      -0.436
146   F       0.825
147   Y      -1.156
148   P       0.139
149   G       2.397
150   E      -0.548
151   T      -0.856
152   V      -0.482
153   V      -0.776
154   H      -0.043
155   G      -0.429
156   P      -0.849
157   G       0.361
158   E      -1.002
159   A      -0.269
160   T      -0.597
161   A       0.299
162   V       0.597
163   E      -0.952
164   W       0.134
165   G      -0.600
166   P      -0.438
167   N      -0.216
168   T       1.007
169   W       1.714
170   M       0.720
171   V       1.593
172   E       2.356
173   Y       3.048
174   G       0.852
175   R       1.759
176   G       3.166
177   V       0.070
178   I       1.170
179   P       1.355
180   S      -0.132
181   T       1.090
182   L       0.731
183   A       0.230
184   F       0.640
185   A       0.219
186   L      -0.151
187   A      -0.233
188   D       0.431
189   T      -0.160
190   V       0.880
191   F       0.662
192   S       0.390
193   T       0.693
194   Q      -0.288
195   D       3.668
196   F       0.344
197   L      -1.206
198   T      -0.055
199   L       0.363
200   F      -0.404
201   Y      -0.849
202   T       0.610
203   L       0.095
204   R      -0.807
205   S      -0.661
206   Y       0.105
207   A      -0.022
208   R      -0.473
209   G      -0.799
210   L       0.384
211   R      -0.563
212   L      -0.959
213   E       0.851
214   L       1.035
215   T      -0.480
216   T      -1.000    *
217   Y      -1.000    *
218   L      -1.000    *
219   F      -1.000    *
220   G      -1.000    *
221   Q      -1.000    *
222   D      -1.000    *
223   P      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 342.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MQWAVGRRWA WAALLLAVAA VLTQVVWLWL GTQSFVFQRE EIAQLARQYA GLDHELAFSR 
        70         80         90        100        110        120 LIVELRRLHP GHVLPDEELQ WVFVNAGGWM GAMCLLHASL SEYVLLFGTA LGSRGHSGRY 
       130        140        150        160        170        180 WAEISDTIIS GTFHQWREGT TKSEVFYPGE TVVHGPGEAT AVEWGPNTWM VEYGRGVIPS 
       190        200        210        220                       TLAFALADTV FSTQDFLTLF YTLRSYARGL RLELTTYLFG QDP

5HK1 (X-Ray,2.51 Å resolution)

SIGMAR1 is an integral membrane-bound protein found in various membranous compartments. It is widely expressed across the brain and functions as chaperone protein that regulates various signaling pathways. Miki et al. found that it accumulates in nuclear aggregates with p62 (NES entry #260) after treatment with leptomycin B. No putative NES has been identified yet. It is unclear whether it contains an NES itself or the change in localization is due to other effects through p62, which contains a putative NES. ^{Ref.1Accumulation of the sigma-1 Receptor Is Common to Neuronal Nuclear Inclusions in Various Neurodegenerative Diseases, Miki et al., Neuropathology, 2014}

[1]. "Accumulation of the sigma-1 Receptor Is Common to Neuronal Nuclear Inclusions in Various Neurodegenerative Diseases"
Miki Y, Mori F, Kon T, Tanji K, Toyoshima Y, Yoshida M, Sasaki H, Kakita A, Takahashi H, Wakabayashi K. (2014) Neuropathology, 34(2):148-58 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©