NESdb

Myelin Basic Protein UniProt

21.5 kDa MBP Isoform

Rattus norvegicus (Rat)

LMB Sensitive ^{Ref.1Regulation of Cell Proliferation by Nucleocytoplasmic Dynamics of Postnatal and Embryonic exon-II-containing MBP Isoforms, Ozgen et al., Biochim Biophys Acta, 2020}

Unknown

Undetermined

Unknown

Show FASTA Format

>sp|P02688|MBP_RAT Myelin basic protein OS=Rattus norvegicus OX=10116 GN=Mbp PE=1 SV=3
MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKV
PWLKQSRSPLPSHARSRPGLCHMYKDSHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTP
RTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFK
LGGRDSRSGSPMARR

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988889877555420002224433346999888998853210011347989988899887
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKV
              10        20        30        40        50        60


Conf: 663588999998889998643101123344467799976557888999537864035689
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCC
  AA: PWLKQSRSPLPSHARSRPGLCHMYKDSHTRTTHYGSLPQKSQRTQDENPVVHFFKNIVTP
              70        80        90       100       110       120


Conf: 999998888865410001245579888789999887631223467776677622445453
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHH
  AA: RTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGAYDAQGTLSKIFK
             130       140       150       160       170       180


Conf: 189999989998779
Pred: CCCCCCCCCCCCCCC
  AA: LGGRDSRSGSPMARR
             190

Show Conservation Score by AL2CO

1     M       1.243
2     A       2.284
3     S       0.462
4     Q       2.284
5     K       1.262
6     R       0.003
7     P       1.056
8     S       2.284
9     Q      -0.481
10    R       0.011
11    H       0.040
12    G       0.580
13    S       0.588
14    K       1.295
15    Y       0.421
16    L       1.054
17    A       2.284
18    T       1.047
19    A       1.352
20    S       1.350
21    T      -0.647
22    M      -1.355
23    D       0.658
24    H       1.095
25    A      -0.046
26    R       0.008
27    H      -0.751
28    G       1.251
29    F      -0.534
30    L      -0.837
31    P      -0.482
32    R       1.265
33    H      -0.848
34    R       0.569
35    D       0.472
36    T      -0.471
37    G       1.310
38    I      -0.083
39    L       1.261
40    D       0.661
41    S       0.455
42    I       1.135
43    G       2.284
44    R       1.130
45    F       1.137
46    F       1.348
47    S       0.458
48    G       0.670
49    D       0.030
50    R       0.475
51    G      -1.937
52    A      -0.832
53    P       0.004
54    K      -0.493
55    R       0.376
56    G       1.374
57    S       0.534
58    G      -1.028
59    K      -0.686
60    V      -1.453
61    P      -1.218
62    W      -0.780
63    L      -1.546
64    K      -1.320
65    Q      -1.108
66    S      -1.285
67    R      -1.317
68    S      -1.362
69    P      -0.736
70    L      -1.019
71    P      -1.057
72    S      -1.661
73    H      -1.268
74    A      -1.507
75    R      -1.289
76    S      -1.039
77    R      -1.532
78    P      -0.307
79    G      -1.050
80    L      -0.539
81    C      -0.774
82    H      -1.551
83    M      -1.364
84    Y      -1.111
85    K       0.009
86    D      -0.662
87    S      -0.866
88    H      -0.012
89    T      -0.433
90    R       0.523
91    T      -0.448
92    T      -0.816
93    H       1.343
94    Y       0.008
95    G       0.424
96    S       0.033
97    L      -0.408
98    P       1.305
99    Q      -0.061
100   K      -1.285
101   S      -0.807
102   Q      -0.850
103   R       0.093
104   T      -1.577
105   Q      -1.319
106   D       0.649
107   E       0.007
108   N       0.100
109   P       0.044
110   V       0.652
111   V       0.119
112   H       1.287
113   F       1.266
114   F       1.349
115   K       0.566
116   N       0.462
117   I      -0.392
118   V       1.186
119   T       1.076
120   P       1.382
121   R      -0.438
122   T      -1.032
123   P       0.574
124   P       0.738
125   P      -0.352
126   S      -1.521
127   Q      -0.615
128   G      -0.490
129   K      -0.411
130   G      -0.245
131   R      -0.511
132   G       0.526
133   L      -0.770
134   S      -0.460
135   L      -0.084
136   S      -0.747
137   R      -0.001
138   F       0.046
139   S      -0.423
140   W       1.368
141   G       0.256
142   A      -0.041
143   E      -0.382
144   G      -0.271
145   Q      -0.722
146   K       1.051
147   P      -0.286
148   G      -0.941
149   F      -1.024
150   G       0.718
151   Y      -1.548
152   G      -0.710
153   G      -1.184
154   R      -0.372
155   A      -1.769
156   S      -0.711
157   D      -1.091
158   Y      -0.842
159   K      -1.029
160   S      -0.719
161   A      -0.633
162   H      -0.753
163   K       0.086
164   G       0.091
165   F      -1.116
166   K      -0.385
167   G       0.117
168   A      -1.061
169   Y      -1.092
170   D       0.531
171   A      -0.025
172   Q      -0.059
173   G       0.595
174   T      -0.004
175   L       1.330
176   S       0.690
177   K       0.351
178   I      -0.058
179   F       2.284
180   K       0.642
181   L       0.511
182   G       2.284
183   G       0.523
184   R      -0.753
185   D      -0.445
186   S       0.544
187   R       1.330
188   S      -0.343
189   G       1.179
190   S       1.373
191   P       1.366
192   M      -0.810
193   A      -0.498
194   R       2.284
195   R       2.284
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 343.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MASQKRPSQR HGSKYLATAS TMDHARHGFL PRHRDTGILD SIGRFFSGDR GAPKRGSGKV 
        70         80         90        100        110        120 PWLKQSRSPL PSHARSRPGL CHMYKDSHTR TTHYGSLPQK SQRTQDENPV VHFFKNIVTP 
       130        140        150        160        170        180 RTPPPSQGKG RGLSLSRFSW GAEGQKPGFG YGGRASDYKS AHKGFKGAYD AQGTLSKIFK 
       190                                                        LGGRDSRSGS PMARR

Not Available

MBP is a structural protein critical for myelin formation in CNS. Exon-II-containing postnatal 21.5-kDa MBP isoform is a nucleoctyoplasmic trafficking protein. Nuclear import of MBP is mediated by a non-traditional PY-NLS. Ozgen et al. found that in the absence of mitogenic signal, exogenously expressed MBP-RFP is exported to the cytoplasm in oligodendrocyte-derived cell line. This export is inhibited by LMB treatment, suggesting that MBP may contain an NES. No putative NES sequences have been identified yet. ^{Ref.1Regulation of Cell Proliferation by Nucleocytoplasmic Dynamics of Postnatal and Embryonic exon-II-containing MBP Isoforms, Ozgen et al., Biochim Biophys Acta, 2020} ^{Ref.2The 21.5-kDa isoform of myelin basic protein has a non-traditional PY-nuclear-localization signal, Smith et al., Biochem Biophys Res Commun, 2012}

[1]. "Regulation of Cell Proliferation by Nucleocytoplasmic Dynamics of Postnatal and Embryonic exon-II-containing MBP Isoforms"
Ozgen H, Kahya N, de Jonge JC, Smith GS, Harauz G, Hoekstra D, Baron W. (2020) Biochim Biophys Acta, 1843(3):517-30 PubMed
[2]. "The 21.5-kDa isoform of myelin basic protein has a non-traditional PY-nuclear-localization signal"
Smith GS, Seymour LV, Boggs JM, Harauz G. (2012) Biochem Biophys Res Commun, 422(4):670-675 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©