NESdb

Programmed cell death protein 4 UniProt

Neoplastic transformation inhibitor protein (TIP), Nuclear antigen H731-like (H731), Protein 197/15a, DUG, MA-3

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Prolyl Isomerase Pin1 Regulates Cadmium-Induced Autophagy via Ubiquitin-Mediated Post-Translational Stabilization of phospho-Ser GSK3alphabeta in Human Hepatocellular Carcinoma Cells, Takaki et al., Mol Cell Biochem, 2018} ^{Ref.2The transformation suppressor protein Pdcd4 shuttles between nucleus and cytoplasm and binds RNA, Bohm et al., Oncogene, 2003}

*highlighted yellow in the full sequence

L243A/L244A/L247A/L250A/L252A, L188A/L191A/L193A ^{Ref.2The transformation suppressor protein Pdcd4 shuttles between nucleus and cytoplasm and binds RNA, Bohm et al., Oncogene, 2003}

Unknown

*shown as underlined residues in the full sequence

²⁴³LLKDLPELALD²⁵³, ¹⁸⁴VAEMLRDLNLG¹⁹⁴ ^{Ref.2The transformation suppressor protein Pdcd4 shuttles between nucleus and cytoplasm and binds RNA, Bohm et al., Oncogene, 2003}

α-helix

Unknown

Show FASTA Format

>sp|Q53EL6|PDCD4_HUMAN Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4 PE=1 SV=2
MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 932000111269999999987865653234685210000159989999875333653666
Pred: CCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHCCCCCCCCCCCCCCCCCCHHHH
  AA: MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
              10        20        30        40        50        60


Conf: 433106799999999988889865567987889999888888877899999887777899
Pred: HHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
              70        80        90       100       110       120


Conf: 876589865568778779999999999972787304899989999887889998730699
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHCCCC
  AA: KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
             130       140       150       160       170       180


Conf: 899999988316999863067999999715995145579999997542999977899999
Pred: HHHHHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHH
  AA: TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
             190       200       210       220       230       240


Conf: 997328895124789944899999999972896783138742188760469999999998
Pred: HHHHCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHCCCCCHHHHHHHHHHHHH
  AA: DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
             250       260       270       280       290       300


Conf: 812245553103433578775418999999999999999829999999999670999974
Pred: HHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCC
  AA: LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
             310       320       330       340       350       360


Conf: 499999999986058833199999999998835987989999999999700683102752
Pred: HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCCCCCCC
  AA: HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
             370       380       390       400       410       420


Conf: 2289999999999985987357762179898643110387543487899
Pred: CHHHHHHHHHHHHHHCCCCCHHHHHHCCCCCCCCCCCCCCCCCCCCCCC
  AA: HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY
             430       440       450       460

Show Conservation Score by AL2CO

1     M      -1.000    *
2     D      -1.000    *
3     V      -1.000    *
4     E      -1.000    *
5     N      -1.000    *
6     E      -1.000    *
7     Q      -1.000    *
8     I      -1.000    *
9     L      -1.000    *
10    N      -1.000    *
11    V      -1.000    *
12    N      -1.000    *
13    P      -1.000    *
14    A      -1.000    *
15    D      -1.000    *
16    P      -1.000    *
17    D      -1.000    *
18    N      -1.000    *
19    L      -1.000    *
20    S      -1.000    *
21    D      -1.000    *
22    S      -1.000    *
23    L      -1.000    *
24    F      -1.000    *
25    S      -1.000    *
26    G      -1.000    *
27    D      -1.000    *
28    E      -1.000    *
29    E      -1.000    *
30    N      -1.000    *
31    A      -1.000    *
32    G      -1.000    *
33    T      -1.000    *
34    E      -1.000    *
35    E      -1.000    *
36    I      -1.000    *
37    K      -1.000    *
38    N      -1.000    *
39    E      -1.000    *
40    I      -1.000    *
41    N      -1.000    *
42    G      -1.000    *
43    N      -1.000    *
44    W      -1.000    *
45    I      -1.000    *
46    S      -1.000    *
47    A      -1.000    *
48    S      -1.000    *
49    S      -1.000    *
50    I      -1.000    *
51    N      -1.000    *
52    E      -1.000    *
53    A      -1.000    *
54    R      -1.000    *
55    I      -1.000    *
56    N      -1.000    *
57    A      -1.000    *
58    K      -1.000    *
59    A      -1.000    *
60    K      -1.000    *
61    R      -1.000    *
62    R      -1.000    *
63    L      -1.000    *
64    R      -1.000    *
65    K      -1.000    *
66    N      -1.000    *
67    S      -1.000    *
68    S      -1.000    *
69    R      -1.000    *
70    D      -1.000    *
71    S      -1.000    *
72    G      -1.000    *
73    R      -1.000    *
74    G      -1.000    *
75    D      -1.000    *
76    S      -1.000    *
77    V      -1.000    *
78    S      -1.000    *
79    D      -1.000    *
80    S      -1.000    *
81    G      -1.000    *
82    S      -1.000    *
83    D      -1.000    *
84    A      -1.000    *
85    L      -1.000    *
86    R      -1.000    *
87    S      -1.000    *
88    G      -1.000    *
89    L      -1.000    *
90    T      -1.000    *
91    V      -1.000    *
92    P      -1.000    *
93    T      -1.000    *
94    S      -1.000    *
95    P      -1.000    *
96    K      -1.000    *
97    G      -1.000    *
98    R      -1.000    *
99    L      -1.000    *
100   L      -1.000    *
101   D      -1.000    *
102   R      -1.000    *
103   R      -1.000    *
104   S      -1.000    *
105   R      -1.000    *
106   S      -1.000    *
107   G      -1.000    *
108   K      -1.000    *
109   G      -1.000    *
110   R      -1.000    *
111   G      -1.000    *
112   L      -1.000    *
113   P      -1.000    *
114   K      -1.000    *
115   K      -1.000    *
116   G      -1.000    *
117   G      -1.000    *
118   A      -1.000    *
119   G      -1.000    *
120   G      -1.000    *
121   K      -1.000    *
122   G      -1.000    *
123   V      -1.000    *
124   W      -1.000    *
125   G      -1.000    *
126   T      -1.000    *
127   P      -1.000    *
128   G       0.558
129   Q      -0.077
130   V      -0.445
131   Y      -0.023
132   D      -0.543
133   V      -0.820
134   E      -0.963
135   E      -1.064
136   V      -0.193
137   D       2.869
138   V      -1.069
139   K      -0.091
140   D       4.015
141   P       3.180
142   N       1.738
143   Y       1.630
144   D       0.752
145   D       0.305
146   D       0.383
147   Q      -0.428
148   E       0.174
149   N      -0.424
150   C      -1.001
151   V      -0.911
152   Y      -0.811
153   E      -1.031
154   T      -0.643
155   V      -0.283
156   V      -1.104
157   L      -0.815
158   P      -0.595
159   L      -1.027
160   D      -0.104
161   E      -0.560
162   R      -0.468
163   A      -0.256
164   F       0.459
165   E      -0.108
166   K      -0.547
167   T      -0.860
168   L       0.313
169   T      -0.904
170   P      -0.879
171   I       0.633
172   I       1.234
173   Q      -0.833
174   E       1.662
175   Y       2.729
176   F       0.879
177   E      -0.656
178   H       0.603
179   G      -0.362
180   D       1.155
181   T      -0.224
182   N      -1.075
183   E       0.529
184   V       0.861
185   A      -0.933
186   E      -0.941
187   M      -0.761
188   L       1.926
189   R      -0.612
190   D       0.086
191   L      -0.611
192   N      -0.292
193   L      -1.109
194   G      -0.423
195   E      -1.031
196   M      -0.583
197   K      -0.582
198   S      -0.583
199   G      -0.858
200   V       1.512
201   P       1.094
202   V      -0.336
203   L      -0.401
204   A       0.739
205   V       2.169
206   S      -0.561
207   L      -0.141
208   A       2.188
209   L       1.255
210   E       1.465
211   G      -0.529
212   K      -0.355
213   A      -0.789
214   S      -0.398
215   H      -0.038
216   R      -0.095
217   E       0.005
218   M       0.083
219   T       0.504
220   S       0.178
221   K      -0.794
222   L       1.648
223   L       0.898
224   S       0.024
225   D      -0.626
226   L       0.845
227   C      -0.311
228   G      -0.759
229   T      -0.832
230   V      -0.274
231   M       0.831
232   S      -0.602
233   T      -1.003
234   T      -0.819
235   D       0.164
236   V       0.841
237   E      -0.726
238   K      -1.088
239   S       2.111
240   F       1.990
241   D      -1.067
242   K      -0.654
243   L       1.090
244   L       0.252
245   K      -0.690
246   D      -0.724
247   L       0.398
248   P       0.021
249   E       2.075
250   L       0.581
251   A      -0.652
252   L       1.818
253   D       2.963
254   T       0.287
255   P       1.818
256   R      -0.717
257   A       1.066
258   P      -0.803
259   Q      -0.971
260   L      -0.738
261   V       0.983
262   G      -0.253
263   Q      -1.025
264   F       1.513
265   I       0.861
266   A      -0.149
267   R       0.461
268   A       1.166
269   V       0.666
270   G      -0.380
271   D       1.065
272   G       0.735
273   I       0.515
274   L       1.641
275   C      -0.078
276   N      -0.042
277   T      -0.692
278   Y      -0.029
279   I       0.218
280   D      -0.964
281   S      -1.005
282   Y      -1.124
283   K      -1.065
284   G      -0.997
285   T      -1.267
286   V      -1.000
287   D      -0.807
288   C      -0.918
289   V      -0.932
290   Q      -1.047
291   A      -0.601
292   R      -1.097
293   A      -0.995
294   A      -0.034
295   L      -0.117
296   D      -0.932
297   K      -0.547
298   A       0.299
299   T      -0.937
300   V      -0.511
301   L      -0.678
302   L       0.505
303   S      -0.829
304   M      -0.793
305   S      -0.345
306   K      -0.809
307   G      -0.516
308   G      -1.063
309   K      -0.899
310   R      -0.777
311   K       0.050
312   D      -0.285
313   S      -0.390
314   V      -0.556
315   W       0.865
316   G       0.802
317   S      -0.916
318   G      -0.229
319   G      -0.549
320   G      -0.553
321   Q      -1.310
322   Q      -0.966
323   S      -0.318
324   V       0.399
325   N      -0.689
326   H      -1.027
327   L       0.243
328   V       0.328
329   K      -0.866
330   E      -0.302
331   I       0.407
332   D      -1.173
333   M      -1.046
334   L       0.181
335   L       1.972
336   K      -0.633
337   E       1.594
338   Y       2.213
339   L      -0.330
340   L      -0.878
341   S       0.563
342   G      -0.184
343   D       0.365
344   I      -0.581
345   S      -1.081
346   E       0.877
347   A       0.405
348   E      -1.029
349   H      -0.528
350   C       0.116
351   L       1.998
352   K      -0.670
353   E       0.157
354   L       0.567
355   E       0.351
356   V      -0.789
357   P       0.179
358   H      -0.674
359   F       0.594
360   H      -0.262
361   H       1.563
362   E       0.773
363   L       1.726
364   V       1.565
365   Y       1.180
366   E       0.438
367   A       0.328
368   I       0.811
369   I      -0.199
370   M      -0.570
371   V       0.621
372   L       0.802
373   E       0.563
374   S      -0.434
375   T      -0.998
376   G      -0.948
377   E      -0.296
378   S      -0.539
379   T      -0.976
380   F      -1.054
381   K      -0.843
382   M      -0.368
383   I       0.357
384   L      -0.355
385   D      -0.848
386   L       1.618
387   L       1.941
388   K      -0.637
389   S      -0.953
390   L       0.151
391   W      -0.965
392   K      -1.156
393   S      -0.561
394   S      -0.849
395   T       0.580
396   I       1.239
397   T       0.548
398   V      -1.042
399   D      -0.291
400   Q       0.324
401   M       0.945
402   K      -0.922
403   R      -0.456
404   G       3.196
405   Y       1.157
406   E      -1.121
407   R       0.779
408   I       0.820
409   Y      -0.890
410   N      -0.574
411   E      -0.648
412   I       1.187
413   P       0.054
414   D       2.411
415   I       0.759
416   N      -0.617
417   L       1.501
418   D       3.363
419   V       0.688
420   P       2.096
421   H      -0.937
422   S       1.118
423   Y      -0.858
424   S      -1.197
425   V      -0.761
426   L       1.298
427   E      -0.584
428   R      -1.252
429   F       0.802
430   V      -0.031
431   E      -0.706
432   E      -0.742
433   C       1.247
434   F      -0.798
435   Q      -0.834
436   A      -0.472
437   G       0.461
438   I       0.138
439   I       1.722
440   S      -0.268
441   K      -0.589
442   Q      -0.688
443   L       0.331
444   R      -0.844
445   D      -0.821
446   L      -0.829
447   C      -0.843
448   P      -0.221
449   S      -0.738
450   R      -0.450
451   G      -1.000    *
452   R      -1.000    *
453   K      -1.000    *
454   R      -1.000    *
455   F      -1.000    *
456   V      -1.000    *
457   S      -1.000    *
458   E      -1.000    *
459   G      -1.000    *
460   D      -1.000    *
461   G      -1.000    *
462   G      -1.000    *
463   R      -1.000    *
464   L      -1.000    *
465   K      -1.000    *
466   P      -1.000    *
467   E      -1.000    *
468   S      -1.000    *
469   Y      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 349.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MDVENEQILN VNPADPDNLS DSLFSGDEEN AGTEEIKNEI NGNWISASSI NEARINAKAK 
        70         80         90        100        110        120 RRLRKNSSRD SGRGDSVSDS GSDALRSGLT VPTSPKGRLL DRRSRSGKGR GLPKKGGAGG 
       130        140        150        160        170        180 KGVWGTPGQV YDVEEVDVKD PNYDDDQENC VYETVVLPLD ERAFEKTLTP IIQEYFEHGD 
       190        200        210        220        230        240 
TNEVAEMLRD LNLGEMKSGV PVLAVSLALE GKASHREMTS KLLSDLCGTV MSTTDVEKSF 
       250        260        270        280        290        300 
DKLLKDLPEL ALDTPRAPQL VGQFIARAVG DGILCNTYID SYKGTVDCVQ ARAALDKATV 
       310        320        330        340        350        360 LLSMSKGGKR KDSVWGSGGG QQSVNHLVKE IDMLLKEYLL SGDISEAEHC LKELEVPHFH 
       370        380        390        400        410        420 HELVYEAIIM VLESTGESTF KMILDLLKSL WKSSTITVDQ MKRGYERIYN EIPDINLDVP 
       430        440        450        460                       HSYSVLERFV EECFQAGIIS KQLRDLCPSR GRKRFVSEGD GGRLKPESY

3EUJ (X-Ray,2.8 Å resolution)

Pdcd4 role in apoptosis and is found in predominantly in the cytosol in normal conditions. Böhm et al. found that Pdcd4 exits the nucleus upon serum withdrawal, which can be inhibited by LMB. 2 NESs was identified, both are active as GST-fusion proteins in peptide level. It should be noted that the sequence presented on the paper is slightly different from the one retrieved from uniport (NES1: LLKDLPDLVLD and NES2: VSEMLKDLNLG). Both NESs are within folded helical domain of Pdcd4 and is likely inaccessible to CRM1 in full-length protein context, thus, under normal conditions, the protein is predominantly cytosolic. Takaki and Eto reported that Pdcd4 is rapidly degraded upon pharmacological activation of apoptosis with nuclear Pdcd4 disappearing before cytosolic Pdcd4, where LMB treatment causes rescues disappearance of nuclear Pdcd4, also suggesting nuclear exit dependent on CRM1. ^{Ref.1Prolyl Isomerase Pin1 Regulates Cadmium-Induced Autophagy via Ubiquitin-Mediated Post-Translational Stabilization of phospho-Ser GSK3alphabeta in Human Hepatocellular Carcinoma Cells, Takaki et al., Mol Cell Biochem, 2018} ^{Ref.2The transformation suppressor protein Pdcd4 shuttles between nucleus and cytoplasm and binds RNA, Bohm et al., Oncogene, 2003}

[1]. "Prolyl Isomerase Pin1 Regulates Cadmium-Induced Autophagy via Ubiquitin-Mediated Post-Translational Stabilization of phospho-Ser GSK3alphabeta in Human Hepatocellular Carcinoma Cells"
Takaki S, Eto K. (2018) Mol Cell Biochem, 448(1-2):155-164 PubMed
[2]. "The transformation suppressor protein Pdcd4 shuttles between nucleus and cytoplasm and binds RNA"
Böhm M, Sawicka K, Siebrasse JP, Brehmer-Fastnacht A, Peters R, Klempnauer KH. (2003) Oncogene, 22(31):4905-10 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©