NESdb

Tristetraproline (TIP) UniProt

Zinc finger protein 36 (Zfp-36)
Protein TIS11A

Rattus norvegicus (Rat)

LMB Sensitive ^{Ref.1Identification of nuclear import and export signals within the structure of the zinc finger protein TIS11, Murata et al., Biochem Biophys Res Commun, 2002}

*highlighted yellow in the full sequence

¹MDLSAIYESLMSMSH¹⁵ by Deletion, L3A/I6A/L10A ^{Ref.1Identification of nuclear import and export signals within the structure of the zinc finger protein TIS11, Murata et al., Biochem Biophys Res Commun, 2002}

Unknown

*shown as underlined residues in the full sequence

¹MDLSAIYESLMSMSHDLSPDHGGTESSGGLWNINSSDSIPSGVTSRLTGRSTSLVEGRSC
SWVPPPPGFAPLAPRPGPELSPSPTSPTATPTTSSRYKTEL¹⁰¹ ^{Ref.1Identification of nuclear import and export signals within the structure of the zinc finger protein TIS11, Murata et al., Biochem Biophys Res Commun, 2002}

Unknown

Show FASTA Format

>gi|1717819|sp|P47973.1|TTP_RAT RecName: Full=Tristetraprolin; Short=TTP; AltName: Full=Protein TIS11A; Short=TIS11; AltName: Full=Zinc finger protein 36; Short=Zfp-36
MDLSAIYESLMSMSHDLSPDHGGTESSGGLWNINSSDSIPSGVTSRLTGRSTSLVEGRSCSWVPPPPGFA
PLAPRPGPELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYGAKCQFAHGPGELRQANRHPKYKTELC
HKFYLQGRCPYGSRCHFIHNPTEDLALPGQPHVLRQSISFSGLPSGRRTSPPPPGFSGPSLSSCSFSPSS
SPPPPGDLPLSPSAFSAAPGTPVSRRDPTPACCPSCRRSTTPSTIWGPLGGLARSPSAHSLGSDPDDYAS
SGSSLGGSDSPVFEAGVFGPPQPPAPPRRLPIFNRISVSE

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 935678775423899999999999878996678899998977676778887641369778
Pred: CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MDLSAIYESLMSMSHDLSPDHGGTESSGGLWNINSSDSIPSGVTSRLTGRSTSLVEGRSC
              10        20        30        40        50        60


Conf: 899999999999999999999999999998877776310212103404888999989788
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCHHHHCCCCCCCCCCCCCC
  AA: SWVPPPPGFAPLAPRPGPELSPSPTSPTATPTTSSRYKTELCRTYSESGRCRYGAKCQFA
              70        80        90       100       110       120


Conf: 794667899999997512012000244447999963357996678799999652223344
Pred: CCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: HGPGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPTEDLALPGQPHVLRQSISF
             130       140       150       160       170       180


Conf: 799999999999999999999999999999999999999998735789999987789999
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: SGLPSGRRTSPPPPGFSGPSLSSCSFSPSSSPPPPGDLPLSPSAFSAAPGTPVSRRDPTP
             190       200       210       220       230       240


Conf: 989989999999999999999989999998999989988899999999999767888899
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: ACCPSCRRSTTPSTIWGPLGGLARSPSAHSLGSDPDDYASSGSSLGGSDSPVFEAGVFGP
             250       260       270       280       290       300


Conf: 99999999887832456679
Pred: CCCCCCCCCCCCCCCCCCCC
  AA: PQPPAPPRRLPIFNRISVSE
             310       320

Show Conservation Score by AL2CO

1     M      -1.000    *
2     D      -1.000    *
3     L      -1.000    *
4     S      -1.000    *
5     A      -1.000    *
6     I      -1.000    *
7     Y      -1.000    *
8     E      -1.000    *
9     S      -1.000    *
10    L      -1.000    *
11    M      -1.000    *
12    S      -1.000    *
13    M      -1.000    *
14    S      -1.000    *
15    H      -1.000    *
16    D      -1.000    *
17    L      -1.000    *
18    S      -1.000    *
19    P      -1.000    *
20    D      -1.000    *
21    H      -1.000    *
22    G      -1.000    *
23    G      -1.000    *
24    T      -1.000    *
25    E      -1.000    *
26    S      -1.000    *
27    S      -1.000    *
28    G      -1.000    *
29    G      -1.000    *
30    L      -1.000    *
31    W      -1.000    *
32    N      -1.000    *
33    I      -1.000    *
34    N      -1.000    *
35    S      -1.000    *
36    S      -1.000    *
37    D      -1.000    *
38    S      -1.000    *
39    I      -1.000    *
40    P      -1.000    *
41    S      -1.000    *
42    G      -1.000    *
43    V      -1.000    *
44    T      -1.000    *
45    S      -1.000    *
46    R      -1.000    *
47    L      -1.000    *
48    T      -1.000    *
49    G      -1.000    *
50    R      -1.000    *
51    S      -1.000    *
52    T      -1.000    *
53    S      -1.000    *
54    L      -1.000    *
55    V      -1.000    *
56    E      -1.000    *
57    G      -1.000    *
58    R      -1.000    *
59    S      -1.000    *
60    C      -1.000    *
61    S      -1.000    *
62    W      -1.000    *
63    V      -1.000    *
64    P      -1.000    *
65    P      -1.000    *
66    P      -1.000    *
67    P      -1.000    *
68    G      -1.000    *
69    F      -1.000    *
70    A      -1.000    *
71    P      -1.000    *
72    L      -1.000    *
73    A      -1.000    *
74    P      -1.000    *
75    R      -1.000    *
76    P      -1.000    *
77    G      -1.000    *
78    P      -1.000    *
79    E      -1.000    *
80    L      -0.555
81    S      -0.521
82    P      -0.162
83    S      -0.332
84    P      -0.251
85    T      -0.422
86    S      -0.513
87    P      -0.106
88    T      -0.339
89    A      -0.342
90    T      -0.438
91    P      -0.105
92    T      -0.282
93    T      -0.397
94    S      -0.361
95    S      -0.219
96    R       0.070
97    Y       0.946
98    K       1.323
99    T       0.271
100   E       0.739
101   L       0.984
102   C       4.166
103   R      -0.144
104   T      -0.448
105   Y       1.136
106   S      -0.158
107   E       0.485
108   S      -0.275
109   G       0.587
110   R      -0.560
111   C       4.825
112   R      -0.052
113   Y       0.425
114   G       2.324
115   A      -0.063
116   K       0.383
117   C       4.558
118   Q       0.314
119   F       2.883
120   A       0.535
121   H       4.284
122   G       1.456
123   P      -0.545
124   G      -0.415
125   E       1.045
126   L       0.741
127   R       0.923
128   Q      -0.634
129   A      -0.098
130   N      -0.572
131   R      -0.061
132   H       0.015
133   P       0.005
134   K       0.325
135   Y      -0.089
136   K       1.022
137   T       0.615
138   E       0.527
139   L       0.076
140   C       3.957
141   H       0.100
142   K       0.423
143   F       1.400
144   Y      -0.622
145   L      -0.263
146   Q      -0.512
147   G       1.702
148   R      -0.381
149   C       3.145
150   P       0.107
151   Y       0.805
152   G       2.321
153   S      -0.058
154   R       0.443
155   C       3.129
156   H      -0.073
157   F       1.699
158   I       0.416
159   H       3.457
160   N      -0.241
161   P      -0.189
162   T      -0.491
163   E      -0.192
164   D      -0.425
165   L      -0.613
166   A      -0.604
167   L      -0.670
168   P      -0.431
169   G      -0.462
170   Q      -0.644
171   P      -0.294
172   H      -0.419
173   V      -0.710
174   L      -0.449
175   R      -0.282
176   Q      -0.524
177   S      -0.231
178   I      -0.473
179   S      -0.178
180   F      -0.602
181   S      -0.483
182   G      -0.324
183   L      -0.681
184   P      -0.268
185   S      -0.534
186   G      -0.607
187   R      -0.451
188   R      -0.599
189   T      -0.673
190   S      -0.489
191   P      -0.507
192   P      -0.569
193   P      -0.338
194   P      -0.523
195   G      -0.592
196   F      -0.534
197   S      -0.562
198   G      -0.422
199   P      -0.588
200   S      -0.565
201   L      -0.448
202   S      -0.554
203   S      -0.755
204   C      -0.620
205   S      -0.595
206   F      -0.591
207   S      -0.493
208   P      -0.280
209   S      -0.425
210   S      -0.312
211   S      -0.401
212   P      -0.552
213   P      -0.267
214   P      -0.463
215   P      -0.194
216   G      -0.547
217   D      -0.690
218   L      -0.382
219   P      -0.547
220   L      -0.627
221   S      -0.549
222   P      -0.254
223   S      -0.515
224   A      -0.492
225   F      -0.540
226   S      -0.674
227   A      -0.618
228   A      -0.477
229   P      -0.578
230   G      -0.648
231   T      -0.683
232   P      -0.139
233   V      -0.697
234   S      -0.674
235   R      -0.732
236   R      -0.689
237   D      -0.355
238   P      -0.496
239   T      -0.457
240   P      -0.250
241   A      -0.471
242   C      -0.523
243   C      -0.452
244   P      -0.488
245   S      -0.743
246   C      -0.590
247   R      -0.591
248   R      -0.538
249   S      -0.614
250   T      -0.655
251   T      -0.603
252   P      -0.331
253   S      -0.401
254   T      -0.540
255   I      -0.666
256   W      -0.416
257   G      -0.415
258   P      -0.159
259   L      -0.525
260   G      -0.440
261   G      -0.471
262   L      -0.049
263   A      -0.562
264   R      -0.551
265   S      -0.456
266   P       0.112
267   S      -0.277
268   A      -0.638
269   H      -0.512
270   S      -0.324
271   L       0.134
272   G      -0.306
273   S      -0.301
274   D      -0.239
275   P      -0.353
276   D      -0.266
277   D      -0.420
278   Y      -0.601
279   A       0.050
280   S      -0.058
281   S      -0.505
282   G      -0.380
283   S       0.046
284   S      -0.192
285   L      -0.457
286   G       0.004
287   G      -1.000    *
288   S      -0.193
289   D      -0.258
290   S      -0.062
291   P      -1.000    *
292   V      -1.000    *
293   F      -1.000    *
294   E      -1.000    *
295   A       0.071
296   G      -0.161
297   V      -1.000    *
298   F      -1.000    *
299   G      -1.000    *
300   P      -1.000    *
301   P      -1.000    *
302   Q      -1.000    *
303   P      -1.000    *
304   P      -1.000    *
305   A      -0.138
306   P       0.071
307   P       0.247
308   R       0.763
309   R       1.832
310   L       2.198
311   P       0.985
312   I       2.342
313   F      -1.000    *
314   N      -1.000    *
315   R      -1.000    *
316   I      -1.000    *
317   S      -1.000    *
318   V      -1.000    *
319   S      -1.000    *
320   E      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 36.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MDLSAIYESL MSMSHDLSPD HGGTESSGGL WNINSSDSIP SGVTSRLTGR STSLVEGRSC 
        70         80         90        100        110        120 
SWVPPPPGFA PLAPRPGPEL SPSPTSPTAT PTTSSRYKTE LCRTYSESGR CRYGAKCQFA 
       130        140        150        160        170        180 HGPGELRQAN RHPKYKTELC HKFYLQGRCP YGSRCHFIHN PTEDLALPGQ PHVLRQSISF 
       190        200        210        220        230        240 SGLPSGRRTS PPPPGFSGPS LSSCSFSPSS SPPPPGDLPL SPSAFSAAPG TPVSRRDPTP 
       250        260        270        280        290        300 ACCPSCRRST TPSTIWGPLG GLARSPSAHS LGSDPDDYAS SGSSLGGSDS PVFEAGVFGP 
       310        320                                             PQPPAPPRRL PIFNRISVSE

Not Available

TIS11 proteins contain two tandem repeats of a putative zinc finger motif. TIS11 functions as a positive transcriptional regulator in the nucleus, and is involved in the destablization of certain mRNAs. Murata et al. demonstrated that GFP-TIS11 is localized both in the cytoplasm and the nucleus, and upon LMB treatment a marked nuclear accumulation was observed. Analysis of a series of TIS11, fused to GFP showed that aa 1-101 is responsible for cytoplasmic location, and aa 88-161 is a functional NLS. However, the structure of the zinc figure is independent of the NLS function. TIS1-101 can export GFP from the nucleus, and upon LMB treatment, the fusion protein is distributed throughout both the cytoplasm and the nucleus. Deletion of aa 1-15 display a diffuse distribution, showing its necessity. The nuclear export activity of GFP1-161 was completely abrogated by L3A/I6A/L10A mutation.

[1]. "Identification of nuclear import and export signals within the structure of the zinc finger protein TIS11"
Murata, T., Yoshino, Y., Morita, N., Kaneda, N. (2002) Biochem Biophys Res Commun, 293:1242-1247 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©