NESdb

Summary for HP1γ (NES ID: 390)

Full Name

Heterochromatin protein 1 homolog gamma UniProt

Alternative Names

Chromobox protein homolog 3 (CBX3)

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Heterochromatin protein (HP)1γ is not only in the nucleus but also in the cytoplasm interacting with actin in both cell compartments, Charo et al., Biochim Biophys Acta Mol Cell Res, 2018} ^{Ref.2Dynamic changes in localization of Chromobox (Cbx) family members during the maternal to embryonic transition, Ruddock et al., Mol Reprod Dev, 2008}

Mutations That Affect Nuclear Export

Unknown

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>sp|Q13185|CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
LDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED
EAQ

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 986643112345423787887667886407998981035769956688641699999998
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEECCEEEEEEEECCCCCCCCC
  AA: MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNT
              10        20        30        40        50        60


Conf: 677989998899999998640487657777877898988765332134546899988899
Pred: CCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARG
              70        80        90       100       110       120


Conf: 998524656469992799986469996542024467662686899987510244699965
Pred: CCCCEEEEEECCCCCEEEEEEECCCCCCCCCHHHHHHHHCCHHHHHHHHHCCCCCCCCCC
  AA: LDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPED
             130       140       150       160       170       180


Conf: 459
Pred: CCC
  AA: EAQ

Show Conservation Score by AL2CO

1     M      -1.000    *
2     A      -1.000    *
3     S      -1.000    *
4     N      -1.000    *
5     K      -1.000    *
6     T      -1.000    *
7     T      -1.000    *
8     L      -1.000    *
9     Q      -1.000    *
10    K      -1.000    *
11    M      -1.000    *
12    G      -1.000    *
13    K      -1.000    *
14    K      -1.000    *
15    Q       0.170
16    N      -0.555
17    G      -0.737
18    K      -0.397
19    S      -0.560
20    K      -0.784
21    K      -0.568
22    V      -0.877
23    E      -0.280
24    E      -0.569
25    A      -0.470
26    E      -0.339
27    P      -0.404
28    E      -0.171
29    E      -0.341
30    F       0.855
31    V       0.074
32    V       2.114
33    E       2.095
34    K      -0.225
35    V       3.105
36    L       0.398
37    D       0.506
38    R      -0.117
39    R       1.417
40    V      -0.404
41    V      -0.925
42    N       0.278
43    G       1.711
44    K      -0.248
45    V      -0.371
46    E       0.258
47    Y       2.842
48    F       0.344
49    L       2.952
50    K       1.609
51    W       2.712
52    K       0.118
53    G       1.401
54    F       1.735
55    T       0.262
56    D      -0.568
57    A      -0.515
58    D      -0.325
59    N       0.311
60    T       2.218
61    W       2.482
62    E       3.168
63    P      -0.155
64    E      -0.245
65    E      -0.020
66    N      -0.076
67    L       0.849
68    D      -0.618
69    C       0.167
70    P      -0.816
71    E      -0.536
72    L       1.070
73    I       0.542
74    E      -0.516
75    A      -0.475
76    F       1.266
77    L      -0.763
78    N      -0.279
79    S      -0.641
80    Q      -1.012
81    K      -0.694
82    A      -0.951
83    G      -0.860
84    K      -0.760
85    E      -0.709
86    K      -0.562
87    D      -0.841
88    G      -0.736
89    T      -0.973
90    K      -0.783
91    R      -0.946
92    K      -0.561
93    S      -0.838
94    L      -0.688
95    S      -0.767
96    D      -0.635
97    S      -1.034
98    E      -0.509
99    S      -0.579
100   D      -0.766
101   D      -0.910
102   S      -0.551
103   K      -0.778
104   S      -0.719
105   K      -0.795
106   K      -0.757
107   K      -0.760
108   R      -0.965
109   D      -0.804
110   A      -0.968
111   A      -0.869
112   D      -0.852
113   K      -0.832
114   P      -0.819
115   R      -0.968
116   G      -0.945
117   F      -1.145
118   A      -0.772
119   R      -1.000
120   G      -0.421
121   L      -1.195
122   D      -0.412
123   P      -0.625
124   E      -0.440
125   R      -0.691
126   I       0.346
127   I      -0.260
128   G      -0.426
129   A      -0.256
130   T      -0.880
131   D      -0.292
132   S      -0.845
133   S      -0.273
134   G       0.912
135   E      -0.389
136   L       0.745
137   M      -0.757
138   F       1.119
139   L       0.616
140   M       1.496
141   K       0.099
142   W       1.513
143   K      -0.562
144   D       0.744
145   S      -0.821
146   D      -0.337
147   E      -0.525
148   A      -0.556
149   D      -0.307
150   L      -0.538
151   V       0.551
152   L      -0.047
153   A      -0.101
154   K      -0.313
155   E       0.106
156   A       0.172
157   N       0.424
158   M      -0.612
159   K      -0.202
160   C       0.946
161   P       1.747
162   Q      -0.105
163   I       0.044
164   V       1.847
165   I       0.543
166   A       0.195
167   F       3.193
168   Y       1.660
169   E       1.864
170   E       0.787
171   R       0.686
172   L       0.940
173   T      -0.332
174   W       1.089
175   H      -0.181
176   S      -0.271
177   C      -0.843
178   P      -0.296
179   E      -1.000    *
180   D      -1.000    *
181   E      -1.000    *
182   A      -1.000    *
183   Q      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 390.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MASNKTTLQK MGKKQNGKSK KVEEAEPEEF VVEKVLDRRV VNGKVEYFLK WKGFTDADNT 
        70         80         90        100        110        120 WEPEENLDCP ELIEAFLNSQ KAGKEKDGTK RKSLSDSESD DSKSKKKRDA ADKPRGFARG 
       130        140        150        160        170        180 LDPERIIGAT DSSGELMFLM KWKDSDEADL VLAKEANMKC PQIVIAFYEE RLTWHSCPED 
                                                                  EAQ

3D Structures in PDB

3DM1 (X-ray,2.4 Å resolution)
6HW2 (X-ray,1.94 Å resolution)

Comments

HP1-gamma is a member of the heterochromatin protein family which is implicated in transcriptional silencing in heterochromatin. These proteins are later found to have diverse roles in the cell. Charo et al. reported that HP1-gamma is also found in the cytoplasm and interacts with actin in both cytoplasm and nucleus. Two studies found that LMB caused nuclear accumulation of the protein. The NES has not been identified yet. ^{Ref.1Heterochromatin protein (HP)1γ is not only in the nucleus but also in the cytoplasm interacting with actin in both cell compartments, Charo et al., Biochim Biophys Acta Mol Cell Res, 2018}

References

[1]. "Heterochromatin protein (HP)1γ is not only in the nucleus but also in the cytoplasm interacting with actin in both cell compartments"
Charó NL, Galigniana NM, Piwien-Pilipuk G. (2018) Biochim Biophys Acta Mol Cell Res, 1865(2):432-443 PubMed
[2]. "Dynamic changes in localization of Chromobox (Cbx) family members during the maternal to embryonic transition"
Ruddock-D'Cruz NT, Prashadkumar S, Wilson KJ, Heffernan C, Cooney MA, French AJ, Jans DA, Verma PJ, Holland MK (2008) Mol Reprod Dev, 75(3):477-88 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©