NESdb

Summary for BToN (NES ID: 402)

Full Name

Nucleocapsid phosphoprotein UniProt

Alternative Names

None

Organism

Bovine torovirus

Experimental Evidence for CRM1-mediated Export

Unknown

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

T153A/F156A/V160A/L162A ^{Ref.1, Ujike et al., ,}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

¹²⁹AAMQIVSGHATVEVSSGDQDTPHKTATFTIKVALN¹⁶³ ^{Ref.1, Ujike et al., ,}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>tr|A0A6M5CI68|A0A6M5CI68_9NIDO Nucleocapsid phosphoprotein OS=Bovine torovirus OX=74501 GN=N PE=4 SV=1
MNSMLNPNAMPFQPQPQVVAMPIQYPMGFQPRFLRRRNLGFRPMFQRRNNSNQNRSRQGR
PRIQNQRRGINISPTQQRANRRQNNQQSLSLPFEQQLLMMANETALSATFPPELQSLAPT
KLVKIAKRAAMQIVSGHATVEVSSGDQDTPHKTATFTIKVALN

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988889998889999816775203789998012210489985100013487644544686
Pred: CCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MNSMLNPNAMPFQPQPQVVAMPIQYPMGFQPRFLRRRNLGFRPMFQRRNNSNQNRSRQGR
              10        20        30        40        50        60


Conf: 135553217899911577777541158889818899988641001103698211145823
Pred: HHHHHHHCCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCH
  AA: PRIQNQRRGINISPTQQRANRRQNNQQSLSLPFEQQLLMMANETALSATFPPELQSLAPT
              70        80        90       100       110       120


Conf: 5799999865455324137996379988985135899987209
Pred: HHHHHHHHHHHHHHCCCEEEEECCCCCCCCCEEEEEEEEEECC
  AA: KLVKIAKRAAMQIVSGHATVEVSSGDQDTPHKTATFTIKVALN
             130       140       150       160

Show Conservation Score by AL2CO

1     M       0.864
2     N       0.864
3     S       0.864
4     M       0.864
5     L       0.864
6     N       0.864
7     P       0.864
8     N       0.864
9     A       0.864
10    M      -0.700
11    P       0.864
12    F      -0.663
13    Q       0.864
14    P       0.864
15    Q      -0.700
16    P       0.864
17    Q       0.864
18    V       0.864
19    V       0.864
20    A       0.864
21    M      -1.621
22    P       0.864
23    I      -0.700
24    Q       0.864
25    Y       0.864
26    P       0.864
27    M      -0.700
28    G       0.864
29    F       0.864
30    Q      -0.700
31    P      -0.667
32    R      -0.700
33    F      -0.667
34    L      -1.608
35    R       0.864
36    R      -0.700
37    R       0.864
38    N      -0.667
39    L      -0.649
40    G      -0.667
41    F       0.864
42    R       0.864
43    P       0.864
44    M       0.864
45    F       0.864
46    Q      -1.621
47    R       0.864
48    R      -0.667
49    N      -0.663
50    N       0.864
51    S      -1.621
52    N       0.864
53    Q      -0.663
54    N       0.864
55    R      -0.663
56    S      -0.663
57    R       0.864
58    Q      -0.663
59    G      -1.593
60    R      -0.663
61    P      -1.623
62    R       0.864
63    I      -0.702
64    Q      -1.594
65    N      -1.621
66    Q      -0.667
67    R      -1.621
68    R      -0.700
69    G      -0.700
70    I      -2.275
71    N      -2.275
72    I      -2.275
73    S      -1.621
74    P      -1.598
75    T      -1.598
76    Q      -1.621
77    Q      -0.667
78    R      -0.667
79    A      -2.275
80    N      -0.667
81    R      -0.667
82    R       0.864
83    Q      -0.667
84    N      -1.621
85    N       0.864
86    Q       0.864
87    Q      -0.700
88    S      -0.648
89    L      -1.621
90    S      -0.663
91    L      -1.593
92    P      -0.667
93    F       0.864
94    E      -0.648
95    Q       0.864
96    Q       0.864
97    L       0.864
98    L       0.864
99    M      -0.667
100   M       0.864
101   A       0.864
102   N       0.864
103   E       0.864
104   T       0.864
105   A       0.864
106   L      -0.700
107   S      -0.700
108   A       0.864
109   T       0.864
110   F      -0.700
111   P       0.864
112   P      -0.667
113   E      -0.667
114   L      -0.700
115   Q       0.864
116   S      -0.700
117   L      -1.621
118   A       0.864
119   P       0.864
120   T       0.864
121   K       0.864
122   L       0.864
123   V       0.864
124   K       0.864
125   I       0.864
126   A       0.864
127   K       0.864
128   R       0.864
129   A      -0.648
130   A       0.864
131   M       0.864
132   Q       0.864
133   I       0.864
134   V       0.864
135   S       0.864
136   G       0.864
137   H       0.864
138   A       0.864
139   T       0.864
140   V       0.864
141   E       0.864
142   V      -0.700
143   S       0.864
144   S      -0.700
145   G       0.864
146   D      -1.608
147   Q      -0.700
148   D       0.864
149   T      -0.700
150   P      -0.700
151   H      -1.621
152   K      -0.700
153   T      -1.608
154   A       0.864
155   T       0.864
156   F       0.864
157   T       0.864
158   I       0.864
159   K       0.864
160   V       0.864
161   A      -0.700
162   L      -0.700
163   N       0.864
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 402.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MNSMLNPNAM PFQPQPQVVA MPIQYPMGFQ PRFLRRRNLG FRPMFQRRNN SNQNRSRQGR 
        70         80         90        100        110        120 PRIQNQRRGI NISPTQQRAN RRQNNQQSLS LPFEQQLLMM ANETALSATF PPELQSLAPT 
       130        140        150        160                       
KLVKIAKRAA MQIVSGHATV EVSSGDQDTP HKTATFTIKV ALN

3D Structures in PDB

Not Available

Comments

Ujike et al.’s subcellular localization studies show that nucleoplasmid (N) protein of bovine Torovirus (a positive-stranded RNA virus), BToN, distinctive from others in the Coronavirus family, was initially nucleolar in infected cells and was subsequently transported to the mainly nucleoplasm during late infection with a minor population found in the cytoplasm, suggesting the presence of trafficking signals within the protein. NESmapper and LocNES predicted two NES motifs, 18-VVAMPI-23 (NES1) and 153-IATFTIKVAL-162 (NES2 – class 1d consensus). Using quantitative fluorescence intensity analysis (QFIA) of cellular localization of EGFP fusion proteins where regions containing putative nuclear localization signals were removed, minimal region required for NES activity was identified to be residues 152-163, however this had lower export activity when compared to the longer construct 129-163. The cellular localization of EGFP proteins fused to full length nor residues 129-163 of N were not LMB sensitive, raising doubt of the CRM1-dependence of the putative NES. Alanine mutations to residues matching NES consensus, from single to 4 alanines in total, however, did result in weaker NES activity, with the effect of F156A and V160A being the most prominent, suggesting they are essential for nuclear export. ^{Ref.1, Ujike et al., ,}

References

[1]. ""
() , : PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©