NESdb

Summary for NADE (NES ID: 48)

Full Name

Protein BEX3 UniProt

Alternative Names

Brain-expressed X-linked protein 3 homolog
p75NTR-associated cell death executor
Nerve growth factor receptor-associated protein 1

Organism

Mus musculus (Mouse)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis, Mukai et al., J Biol Chem, 2002}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L94A/L97A ^{Ref.2NADE, a p75NTR-associated cell death executor, is involved in signal transduction mediated by the common neurotrophin receptor p75NTR, Mukai et al., J Biol Chem, 2000}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|81882075|sp|Q9WTZ9.1|BEX3_MOUSE RecName: Full=Protein BEX3; AltName: Full=Brain-expressed X-linked protein 3 homolog; AltName: Full=Nerve growth factor receptor-associated protein 1; AltName: Full=p75NTR-associated cell death executor
MANVHQENEEMEQPLQNGQEDRPVGGGEGHQPAANNNNNNHNHNHNHHRRGQARRLAPNFRWAIPNRQMN
DGLGGDGDDMEMFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 987301020025665468788889999887678888898888888775445214558643
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
  AA: MANVHQENEEMEQPLQNGQEDRPVGGGEGHQPAANNNNNNHNHNHNHHRRGQARRLAPNF
              10        20        30        40        50        60


Conf: 212574554799999962488989999999999877654201201108999999877753
Pred: CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCEEECCCCCCCCCCCCCC
  AA: RWAIPNRQMNDGLGGDGDDMEMFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEF
              70        80        90       100       110       120


Conf: 1169
Pred: CCCC
  AA: CLMP

Show Conservation Score by AL2CO

1     M       2.102
2     A       0.327
3     N       0.100
4     V      -1.011
5     H      -1.673
6     Q      -0.418
7     E       0.514
8     N      -0.990
9     E      -0.293
10    E      -0.675
11    M      -1.136
12    E      -0.858
13    Q      -0.533
14    P      -0.933
15    L      -1.607
16    Q      -0.536
17    N      -0.873
18    G      -0.245
19    Q      -0.655
20    E      -0.710
21    D      -0.774
22    R      -0.932
23    P      -0.617
24    V      -0.415
25    G      -0.341
26    G      -0.858
27    G      -0.356
28    E       0.748
29    G      -1.203
30    H      -1.314
31    Q      -0.865
32    P       0.588
33    A      -0.682
34    A      -0.331
35    N       0.299
36    N      -0.820
37    N      -1.000    *
38    N      -1.000    *
39    N      -1.000    *
40    N      -1.000    *
41    H      -1.000    *
42    N      -1.000    *
43    H      -1.000    *
44    N      -1.000    *
45    H      -1.000    *
46    N      -1.000    *
47    H      -1.000    *
48    H      -1.000    *
49    R       0.957
50    R      -0.190
51    G      -0.615
52    Q      -1.365
53    A      -0.837
54    R      -0.792
55    R      -0.033
56    L       0.132
57    A       0.035
58    P      -0.429
59    N      -1.064
60    F      -0.258
61    R       0.162
62    W      -0.248
63    A       0.002
64    I       0.053
65    P      -1.092
66    N      -0.989
67    R       0.729
68    Q      -0.564
69    M      -1.149
70    N      -0.660
71    D      -0.049
72    G      -0.646
73    L      -0.731
74    G      -1.358
75    G      -0.198
76    D      -0.358
77    G      -0.187
78    D       0.630
79    D       0.195
80    M      -0.234
81    E       1.105
82    M       0.030
83    F      -0.511
84    M      -0.347
85    E       0.056
86    E       1.310
87    M      -0.101
88    R      -0.083
89    E      -0.351
90    I       0.567
91    R       0.784
92    R       0.937
93    K       1.360
94    L       0.177
95    R       0.668
96    E       0.490
97    L      -0.198
98    Q       1.796
99    L      -0.417
100   R       0.002
101   N      -0.539
102   C      -0.716
103   L      -0.822
104   R      -0.185
105   I      -0.938
106   L       0.483
107   M       0.097
108   G      -0.378
109   E       1.523
110   L       0.874
111   S      -1.000    *
112   N       0.956
113   H       1.713
114   H       0.998
115   D       1.560
116   H       2.259
117   H       1.110
118   D       0.225
119   E       1.578
120   F       2.621
121   C       2.424
122   L       2.348
123   M       0.602
124   P       4.063
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 48.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MANVHQENEE MEQPLQNGQE DRPVGGGEGH QPAANNNNNN HNHNHNHHRR GQARRLAPNF 
        70         80         90        100        110        120 
RWAIPNRQMN DGLGGDGDDM EMFMEEMREI RRKLRELQLR NCLRILMGEL SNHHDHHDEF 
                                                                  CLMP

3D Structures in PDB

Not Available

Comments

Nerve growth factor (NGF) has effect on the apoptosis of nervous systems. p75 nerotrophin receptor (p75NTR) is a cell surface receptor recognized by NGF during NGF-induced apoptosis. NADE (p75NTR-associated cell death executor) is a p75NTR-associated protien that mediates apoptosis in response to NGF. Through mutational analysis, Mukai et al. identified aa 72-112 are essential for NGF-dependent regulation of apoptosis. Interestingly, they also found aa 41-71 are sufficient to induce apoptosis without p75NTR. Wild-type NADE is localized exclusively in the cytoplasm. Mutations of L94A/L97A/L99A lead to a whole cell distribution. Note that single mutation L99A has no effect on its cellular distribution. In another paper, Mukai et al. 2000, found that L94A/L97A also resulted in nuclear retention. Taken together, I think only L94 and L97 are important. LMB treatment of cells containing wild type NADE also cause diffusely distribution of NADE. In addition, they found that NES motif is also crucial for self-association and NGF dependent apoptosis.

References

[1]. "Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis"
Mukai, J., Shoji, S., Kimura, M.T., Okubo, S., Sano, H., Suvanto, P., Li, Y., Irie, S., Sato, T.A. (2002) J Biol Chem, 277:13973-13982 PubMed
[2]. "NADE, a p75NTR-associated cell death executor, is involved in signal transduction mediated by the common neurotrophin receptor p75NTR"
Mukai, J., Hachiya, T., Shoji-Hoshino, S., Kimura, M.T., Nadano, D., Suvanto, P., Hanaoka, T., Li, Y., Irie, S., Greene, L.A., Sato, T.A. (2000) J Biol Chem, 275:17566-17570 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©