NESdb

Summary for PKIα (NES ID: 5)

Full Name

cAMP-dependent Protein Kinase Inhibitor alpha UniProt

Alternative Names

cAMP-dependent protein kinase inhibitor, muscle/brain isoform PKI-alpha

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.2A comparison of the activity, sequence specificity, and CRM1-dependence of different nuclear export signals, Henderson et al., Exp Cell Res, 2000}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L38A/L42A, L45A, I47A ^{Ref.1Identification of a signal for rapid export of proteins from the nucleus, Wen et al., Cell, 1995}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

³⁶NELALKLAGLDINKT⁵⁰ ^{Ref.1Identification of a signal for rapid export of proteins from the nucleus, Wen et al., Cell, 1995}

Secondary Structure of Export Signal

α-helix (residues 36-39), followed by loop

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|48428970|sp|P61925.2|IPKA_HUMAN RecName: Full=cAMP-dependent protein kinase inhibitor alpha; Short=PKI-alpha; AltName: Full=cAMP-dependent protein kinase inhibitor, muscle/brain isoform
MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGE
AAKSES

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 962004567787514344211133111467787806886676424444667864545788
Pred: CCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCC
  AA: MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSS
              10        20        30        40        50        60


Conf: 7678531142256899
Pred: CCCCCCCCCCCCCCCC
  AA: TEQSGEAQGEAAKSES
              70

Show Conservation Score by AL2CO

1     M       1.520
2     T       0.948
3     D       1.336
4     V       1.633
5     E       2.216
6     T      -0.224
7     T      -0.140
8     Y       0.151
9     A      -0.416
10    D       0.017
11    F       2.216
12    I       0.297
13    A       0.006
14    S       0.845
15    G       0.178
16    R       1.701
17    T       0.316
18    G       1.701
19    R       1.701
20    R       2.216
21    N       1.701
22    A       1.692
23    I       0.489
24    H       0.604
25    D       1.077
26    I       1.703
27    L      -0.648
28    V      -0.228
29    S      -0.511
30    S      -1.095
31    A      -0.578
32    S      -0.989
33    G      -0.902
34    N      -0.258
35    S      -0.584
36    N      -0.451
37    E       0.083
38    L       0.932
39    A       0.160
40    L      -1.202
41    K      -0.284
42    L       0.621
43    A       0.103
44    G      -0.709
45    L       1.448
46    D      -0.414
47    I       0.159
48    N      -0.118
49    K      -0.258
50    T      -0.651
51    E      -0.570
52    G      -0.803
53    E      -0.975
54    E      -0.611
55    D      -0.731
56    A      -0.926
57    Q      -0.904
58    R      -1.213
59    S      -0.868
60    S      -1.038
61    T      -1.022
62    E      -0.729
63    Q      -1.269
64    S      -0.970
65    G      -1.061
66    E      -1.052
67    A      -0.950
68    Q      -0.531
69    G      -0.951
70    E      -0.657
71    A      -0.604
72    A      -0.677
73    K      -1.000    *
74    S      -1.000    *
75    E      -1.000    *
76    S      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 5.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 
MTDVETTYAD FIASGRTGRR NAIHDILVSS ASGNSNELAL KLAGLDINKT EGEEDAQRSS 
        70                                                        TEQSGEAQGE AAKSES

3D Structures in PDB

1CMK (X-Ray,2.90 Å resolution)
1XH6 (X-Ray,1.90 Å resolution)
2UVZ (X-Ray,1.94 Å resolution)
3NBY (X-Ray,3.42 Å resolution)

Comments

PKIα is an inhibitor of cAMP-dependent protein kinase and it also controls its localization. The first 25 residues contains the high affinity binding region, followed by kinase pseudo-substrate sequence. Residues 35-49 can function autonomously as an export signal. It has been shown to export GST, as well as the catalytic subunit of cAPK in complex with its inhibitor. Residues 35-44 form α-helix structure as shown by chemical shift index analysis. 3D structures (1CMK, 1XH6, and 2UVZ)are protein complexes containing fragment 6-25 of PKI-alpha. 3NBY is a complex of CRM1-RanGTP-SNUPN with PKI NES.

References

[1]. "Identification of a signal for rapid export of proteins from the nucleus"
Wen, W., Meinkoth, J.L., Tsien, R.Y., Taylor, S.S. (1995) Cell, 82:463-473 PubMed
[2]. "A comparison of the activity, sequence specificity, and CRM1-dependence of different nuclear export signals"
Henderson, B.R., Eleftheriou, A. (2000) Exp Cell Res, 256:213-224 PubMed
[3]. "NESbase version 1.0: a database of nuclear export signals."
la Cour T, Gupta R, Rapacki K, Skriver K, Poulsen FM, Brunak S (2003) Nucleic Acids Res, 31:393-6 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©