NESdb

G1/S-specific cyclin-D1 UniProt

B-cell lymphoma 1 protein (BCL-1)
BCL-1 oncogene
PRAD1 oncogene

Homo sapiens (Human)

LMB Sensitive, Binds CRM1 ^{Ref.1Phosphorylation-dependent regulation of cyclin D1 nuclear export and cyclin D1-dependent cellular transformation., Alt et al., Genes Dev, 2000} ^{Ref.2C-terminal sequences direct cyclin D1-CRM1 binding., Benzeno et al., J Biol Chem, 2004}

*highlighted yellow in the full sequence

V290A/V293A/I295A ^{Ref.2C-terminal sequences direct cyclin D1-CRM1 binding., Benzeno et al., J Biol Chem, 2004}

Unknown

Undetermined

unstructured

Unknown

Show FASTA Format

>gi|116152|sp|P24385.1|CCND1_HUMAN RecName: Full=G1/S-specific cyclin-D1; AltName: Full=B-cell lymphoma 1 protein; Short=BCL-1; AltName: Full=BCL-1 oncogene; AltName: Full=PRAD1 oncogene
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEE
QKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQM
ELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVA
AVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEE
VDLACTPTDVRDVDI

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 976333222232001179956442799999999678159999941112578760257899
Pred: CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHH
  AA: MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
              10        20        30        40        50        60


Conf: 999897643210355543552343333223587666531365678998541002257887
Pred: HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCC
  AA: ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
              70        80        90       100       110       120


Conf: 103230047988835652004877634044102589142699899749975000999999
Pred: HHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHCCCCCCCHHHHHH
  AA: AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
             130       140       150       160       170       180


Conf: 997988742047565446715888889999998408999998313626779866530889
Pred: HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHCCC
  AA: HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
             190       200       210       220       230       240


Conf: 7899999999999999865665310496544675000014899999987555679
Pred: HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCC
  AA: PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
             250       260       270       280       290

Show Conservation Score by AL2CO

1     M      -1.000    *
2     E      -1.000    *
3     H      -1.000    *
4     Q      -1.000    *
5     L      -1.000    *
6     L      -1.000    *
7     C      -1.000    *
8     C      -1.000    *
9     E      -1.000    *
10    V      -1.000    *
11    E      -1.000    *
12    T      -0.795
13    I      -0.447
14    R      -0.708
15    R      -0.984
16    A      -0.329
17    Y      -1.237
18    P      -1.223
19    D       0.317
20    A      -0.855
21    N      -0.706
22    L      -0.081
23    L      -0.301
24    N      -0.660
25    D      -0.236
26    R       0.769
27    V       0.861
28    L       0.547
29    R      -0.807
30    A       0.061
31    M       0.052
32    L      -0.420
33    K      -0.828
34    A      -0.743
35    E       1.624
36    E      -1.085
37    T      -0.858
38    C      -0.965
39    A      -0.784
40    P       0.522
41    S      -0.947
42    V      -0.874
43    S      -0.715
44    Y       1.775
45    F       0.856
46    K      -0.473
47    C      -0.936
48    V      -0.474
49    Q       2.568
50    K      -0.903
51    E       0.180
52    V       1.083
53    L      -0.390
54    P      -0.619
55    S      -0.895
56    M       1.885
57    R       3.254
58    K      -0.389
59    I       0.913
60    V       2.010
61    A       0.655
62    T      -0.139
63    W       2.865
64    M       1.231
65    L       0.003
66    E       0.893
67    V       2.568
68    C       0.302
69    E      -0.724
70    E       0.301
71    Q       0.567
72    K      -0.360
73    C       0.784
74    E      -0.755
75    E      -0.458
76    E       1.099
77    V       1.195
78    F       0.943
79    P       0.301
80    L       0.393
81    A       0.734
82    M       0.315
83    N       0.071
84    Y       0.427
85    L       0.648
86    D       3.166
87    R       0.644
88    F       0.894
89    L       2.173
90    S       0.555
91    L      -1.199
92    E      -0.822
93    P      -1.092
94    V       0.798
95    K      -0.818
96    K       0.474
97    S      -0.925
98    R      -0.393
99    L       1.463
100   Q       2.025
101   L       2.045
102   L       1.231
103   G       3.106
104   A       0.190
105   T       0.690
106   C       1.113
107   M       0.907
108   F       1.093
109   V       1.095
110   A       1.496
111   S       1.176
112   K       2.055
113   M       0.304
114   K       1.001
115   E       1.306
116   T      -0.105
117   I      -1.007
118   P       0.293
119   L       0.919
120   T      -0.823
121   A       0.326
122   E      -0.394
123   K      -0.300
124   L       1.197
125   C       0.160
126   I      -0.692
127   Y       0.516
128   T       0.973
129   D       0.834
130   N      -0.054
131   S       0.609
132   I       0.760
133   R      -0.798
134   P      -0.979
135   E      -0.923
136   E       0.962
137   L       1.137
138   L      -0.039
139   Q      -0.683
140   M       0.585
141   E       2.939
142   L      -0.803
143   L      -0.951
144   L       0.719
145   V       1.758
146   N      -0.419
147   K      -0.925
148   L       1.428
149   K      -0.555
150   W       1.700
151   N      -0.292
152   L       1.095
153   A      -0.328
154   A      -0.797
155   M       0.880
156   T       0.722
157   P       0.422
158   H      -0.641
159   D      -0.660
160   F       1.861
161   I       0.900
162   E      -0.602
163   H      -0.813
164   F       0.773
165   L      -0.377
166   S      -1.036
167   K      -0.639
168   M      -0.776
169   P      -0.821
170   E      -0.991
171   A      -1.014
172   E      -1.101
173   E      -1.123
174   N      -1.141
175   K      -0.904
176   Q      -1.173
177   I      -0.802
178   I      -0.250
179   R      -0.749
180   K      -0.705
181   H       0.520
182   A       0.319
183   Q      -0.702
184   T       0.166
185   F       0.011
186   V       0.023
187   A       0.223
188   L       0.318
189   C      -0.141
190   A      -0.148
191   T      -0.362
192   D       0.254
193   V      -0.672
194   K      -0.577
195   F       0.241
196   I       0.008
197   S      -0.929
198   N      -0.259
199   P      -0.725
200   P       1.477
201   S       2.977
202   M      -0.634
203   V       0.528
204   A       1.506
205   A       1.054
206   G       0.932
207   S       0.568
208   V      -0.090
209   V      -0.296
210   A       0.146
211   A       1.943
212   V      -0.577
213   Q      -1.042
214   G      -0.310
215   L       0.312
216   N      -0.709
217   L      -1.054
218   R      -1.067
219   S      -1.187
220   P      -0.712
221   N      -0.557
222   N      -1.046
223   F      -1.162
224   L      -0.940
225   S      -0.906
226   Y      -0.906
227   Y      -0.665
228   R      -0.822
229   L      -0.786
230   T      -0.921
231   R      -0.795
232   F      -0.871
233   L      -0.612
234   S      -0.988
235   R      -1.004
236   V      -0.793
237   I      -0.456
238   K      -0.680
239   C      -0.201
240   D      -0.701
241   P      -0.869
242   D      -0.874
243   C      -0.808
244   L       0.473
245   R      -0.894
246   A      -0.841
247   C       0.322
248   Q      -0.719
249   E      -0.863
250   Q      -0.909
251   I      -0.091
252   E      -0.711
253   A      -0.942
254   L      -0.764
255   L      -0.792
256   E      -0.918
257   S      -0.849
258   S      -0.515
259   L      -0.820
260   R      -0.818
261   Q      -0.947
262   A      -0.915
263   Q      -0.807
264   Q      -0.564
265   N      -0.587
266   M      -1.003
267   D      -1.000    *
268   P      -1.000    *
269   K      -1.000    *
270   A      -1.000    *
271   A      -1.000    *
272   E      -1.000    *
273   E      -1.000    *
274   E      -1.000    *
275   E      -1.000    *
276   E      -1.000    *
277   E      -1.000    *
278   E      -1.000    *
279   E      -1.000    *
280   E      -1.000    *
281   V      -1.000    *
282   D      -1.000    *
283   L      -1.000    *
284   A      -1.000    *
285   C      -1.000    *
286   T      -1.000    *
287   P      -1.000    *
288   T      -1.000    *
289   D      -1.000    *
290   V      -1.000    *
291   R      -1.000    *
292   D      -1.000    *
293   V      -1.000    *
294   D      -1.000    *
295   I      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 54.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MEHQLLCCEV ETIRRAYPDA NLLNDRVLRA MLKAEETCAP SVSYFKCVQK EVLPSMRKIV 
        70         80         90        100        110        120 ATWMLEVCEE QKCEEEVFPL AMNYLDRFLS LEPVKKSRLQ LLGATCMFVA SKMKETIPLT 
       130        140        150        160        170        180 AEKLCIYTDN SIRPEELLQM ELLLVNKLKW NLAAMTPHDF IEHFLSKMPE AEENKQIIRK 
       190        200        210        220        230        240 HAQTFVALCA TDVKFISNPP SMVAAGSVVA AVQGLNLRSP NNFLSYYRLT RFLSRVIKCD 
       250        260        270        280        290            
PDCLRACQEQ IEALLESSLR QAQQNMDPKA AEEEEEEEEE VDLACTPTDV RDVDI

3G33 (X-Ray,3.0 Å resolution)

During G1 phase, cyclins D1-D3 accumulate and assemble with CDk4/CDK6 in response to mitogenic growth factor. Alt et al. showed that during S phase, cyclin D1 is exported from the nucleus. The export is LMB sensitive and regulated by the GSK-3β-dependent phosphorylation of cyclin D1 on Thr 286. Benzeno et al. showed that C-terminus mediates the immunocoprecipitation between Cyclin D1 and CRM1. Cyclin D1 is overexpressed in human cancers. Several mutations impairs phosphorylation of Thr 286, thus causing the nuclear export defect. ^{Ref.3Identification of mutations that disrupt phosphorylation-dependent nuclear export of cyclin D1., Benzeno et al., Oncogene, 2006}

[1]. "Phosphorylation-dependent regulation of cyclin D1 nuclear export and cyclin D1-dependent cellular transformation."
Alt JR, Cleveland JL, Hannink M, Diehl JA (2000) Genes Dev, 14:3102-14 PubMed
[2]. "C-terminal sequences direct cyclin D1-CRM1 binding."
Benzeno S, Diehl JA (2004) J Biol Chem, 279:56061-6 PubMed
[3]. "Identification of mutations that disrupt phosphorylation-dependent nuclear export of cyclin D1."
Benzeno S, Lu F, Guo M, Barbash O, Zhang F, Herman JG, Klein PS, Rustgi A, Diehl JA (2006) Oncogene, 25:6291-303 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©