NESdb

Summary for RanBP1 (NES ID: 7)

Full Name

Ran-specific GTPase-activating protein (Ran Binding Protein) UniProt

Alternative Names

Ran-binding protein 1

Organism

Homo sapiens (Human)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive, Inhibit or inhibited by other CRM1 cargos ^{Ref.1Mutations in the nuclear export signal of human ran-binding protein RanBP1 block the Rev-mediated posttranscriptional regulation of human immunodeficiency virus type 1., Zolotukhin et al., J Biol Chem, 1997} ^{Ref.3A comparison of the activity, sequence specificity, and CRM1-dependence of different nuclear export signals, Henderson et al., Exp Cell Res, 2000}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L184A, L187A, V189A ^{Ref.1Mutations in the nuclear export signal of human ran-binding protein RanBP1 block the Rev-mediated posttranscriptional regulation of human immunodeficiency virus type 1., Zolotukhin et al., J Biol Chem, 1997} ^{Ref.2A nuclear export signal is essential for the cytosolic localization of the Ran binding protein, RanBP1, Richards et al., J Cell Biol, 1996}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

*shown as underlined residues in the full sequence

¹⁷⁹KVAEKLEALSVKEETKED¹⁹⁶ ^{Ref.1Mutations in the nuclear export signal of human ran-binding protein RanBP1 block the Rev-mediated posttranscriptional regulation of human immunodeficiency virus type 1., Zolotukhin et al., J Biol Chem, 1997} ^{Ref.2A nuclear export signal is essential for the cytosolic localization of the Ran binding protein, RanBP1, Richards et al., J Cell Biol, 1996}

Secondary Structure of Export Signal

Unknown

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|1172837|sp|P43487.1|RANG_HUMAN RecName: Full=Ran-specific GTPase-activating protein; AltName: Full=Ran-binding protein 1; Short=RanBP1
MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFASENDLPEWKER
GTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAWVWNTHADFADECPKPELLAI
RFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQ

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988889998889988887777899963210007831033587302455220320764204
Pred: CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCEEEEEEC
  AA: MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
              10        20        30        40        50        60


Conf: 899542123123115997745799187998633421100111456755874279999228
Pred: CCCCCCCEEECCCEEEEEEECCCCCEEEEEEECCCCCEECCCCCCCCEEEEECCCCCCEE
  AA: ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
              70        80        90       100       110       120


Conf: 993306688899962279998299988999999999999999987662299999813466
Pred: EEEECCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH
  AA: VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
             130       140       150       160       170       180


Conf: 765320375555652001019
Pred: HHHHHHCCCCCCCCCCHHHCC
  AA: AEKLEALSVKEETKEDAEEKQ
             190       200

Show Conservation Score by AL2CO

1     M      -1.000    *
2     A      -1.000    *
3     A      -1.000    *
4     A      -1.000    *
5     K      -1.000    *
6     D      -1.000    *
7     T      -0.689
8     H      -0.830
9     E      -0.749
10    D      -0.463
11    H      -0.725
12    D      -0.797
13    T      -0.801
14    S      -0.723
15    T      -0.875
16    E      -0.816
17    N      -0.958
18    T      -0.958
19    D      -0.785
20    E      -0.256
21    S      -0.822
22    N      -0.223
23    H      -0.799
24    D      -0.496
25    P       0.061
26    Q      -0.056
27    F       0.885
28    E       0.230
29    P       1.903
30    I       0.914
31    V       0.806
32    S      -0.408
33    L       1.604
34    P       0.114
35    E      -0.386
36    Q       0.472
37    E      -0.197
38    I      -0.184
39    K      -0.733
40    T       0.879
41    L      -0.178
42    E       2.036
43    E       2.573
44    D      -0.053
45    E       0.678
46    E      -0.690
47    E      -0.573
48    L      -0.165
49    F       0.713
50    K      -0.633
51    M      -1.017
52    R       1.664
53    A       0.651
54    K       0.752
55    L       1.876
56    F       1.157
57    R       0.308
58    F       0.714
59    A      -0.575
60    S      -0.774
61    E      -0.243
62    N      -0.132
63    D      -1.000    *
64    L      -0.737
65    P      -0.449
66    E       0.448
67    W       3.030
68    K       1.356
69    E       1.567
70    R       2.179
71    G       2.991
72    T       0.497
73    G       3.262
74    D      -0.394
75    V       0.694
76    K       1.854
77    L       1.264
78    L       1.555
79    K      -0.724
80    H      -0.069
81    K      -0.963
82    E      -0.769
83    K      -0.623
84    G      -0.677
85    A      -0.770
86    I      -0.714
87    R       2.384
88    L       0.533
89    L       0.914
90    M       1.113
91    R       1.293
92    R       1.837
93    D       1.133
94    K      -0.073
95    T       0.983
96    L       0.228
97    K       1.805
98    I       1.049
99    C       0.299
100   A       0.813
101   N       1.832
102   H       0.629
103   Y      -1.094
104   I       1.232
105   T      -1.080
106   P      -0.573
107   M      -1.040
108   M      -0.220
109   E      -0.983
110   L       0.528
111   K      -0.802
112   P      -0.914
113   N      -0.510
114   A      -0.950
115   G      -0.586
116   S      -0.202
117   D      -0.508
118   R       0.000
119   A      -0.042
120   W      -0.021
121   V      -0.290
122   W       1.219
123   N      -0.968
124   T       0.317
125   H      -0.906
126   A      -0.937
127   D       0.984
128   F      -0.329
129   A       0.218
130   D       0.215
131   E      -0.085
132   C      -0.831
133   P      -0.887
134   K      -0.611
135   P      -1.159
136   E      -0.465
137   L      -0.560
138   L       1.367
139   A       0.246
140   I       0.730
141   R       0.960
142   F       2.141
143   L      -0.016
144   N      -0.116
145   A      -0.865
146   E       0.279
147   N      -0.798
148   A       0.538
149   Q      -0.789
150   K      -0.876
151   F       1.962
152   K      -0.469
153   T      -0.691
154   K      -0.694
155   F       0.642
156   E      -0.770
157   E      -0.556
158   C      -0.090
159   R      -0.251
160   K      -0.727
161   E      -1.011
162   I      -0.721
163   E      -0.778
164   E      -0.808
165   R      -0.995
166   E      -1.053
167   K      -0.918
168   K      -0.900
169   A      -1.105
170   G      -1.026
171   S      -0.935
172   G      -0.920
173   K      -1.019
174   N      -0.716
175   D      -0.813
176   H      -0.931
177   A      -0.851
178   E      -0.870
179   K      -0.702
180   V      -0.833
181   A      -0.653
182   E      -0.768
183   K      -0.799
184   L      -1.000    *
185   E      -1.000    *
186   A      -1.000    *
187   L      -1.000    *
188   S      -1.000    *
189   V      -1.000    *
190   K      -1.000    *
191   E      -1.000    *
192   E      -1.000    *
193   T      -1.000    *
194   K      -1.000    *
195   E      -1.000    *
196   D      -1.000    *
197   A      -1.000    *
198   E      -1.000    *
199   E      -1.000    *
200   K      -1.000    *
201   Q      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 7.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MAAAKDTHED HDTSTENTDE SNHDPQFEPI VSLPEQEIKT LEEDEEELFK MRAKLFRFAS 
        70         80         90        100        110        120 ENDLPEWKER GTGDVKLLKH KEKGAIRLLM RRDKTLKICA NHYITPMMEL KPNAGSDRAW 
       130        140        150        160        170        180 
VWNTHADFAD ECPKPELLAI RFLNAENAQK FKTKFEECRK EIEEREKKAG SGKNDHAEKV 
       190        200                                             
AEKLEALSVK EETKEDAEEK Q

3D Structures in PDB

1K5D (X-Ray,2.70 Å resolution)

Comments

RanBP1 forms complex with Ran GTPase and RanGAP, promoting the hydrolysis of GTP to GDP. It is found primarily in the cytoplasm. AA 179-196 can carry the GFP-GST protein out of the nucleus after being injected into the cytoplasm. However, the same sequence failed to export the Ran binding domain of RanBP1. The 3D structure does not include the NES, which is located in a disordered region C-terminus of the RanBP1 domain. The original paper by Zolotukhin mislabeled the hydrophobic residue mutations.

References

[1]. "Mutations in the nuclear export signal of human ran-binding protein RanBP1 block the Rev-mediated posttranscriptional regulation of human immunodeficiency virus type 1."
Zolotukhin, A.S., Felber, B.K. (1997) J Biol Chem, 272:11356-60 PubMed
[2]. "A nuclear export signal is essential for the cytosolic localization of the Ran binding protein, RanBP1"
Richards, S.A., Lounsbury, K.M., Carey, K.L., Macara, I.G. (1996) J Cell Biol, 134:1157-1168 PubMed
[3]. "A comparison of the activity, sequence specificity, and CRM1-dependence of different nuclear export signals"
Henderson, B.R., Eleftheriou, A. (2000) Exp Cell Res, 256:213-224 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©