NESdb

Summary for Vpr (HIV-1) (NES ID: 86)

Full Name

Viral protein R UniProt

Alternative Names

R ORF protein

Organism

Human immunodeficiency virus type 1 (isolate BRU/LAI group M subtype B) (HIV-1)

Experimental Evidence for CRM1-mediated Export

LMB Sensitive ^{Ref.1Nucleocytoplasmic shuttling by human immunodeficiency virus type 1 Vpr., Sherman et al., J. Virol., 2001}

Mutations That Affect Nuclear Export

*highlighted yellow in the full sequence

L64A/L67A/L68A ^{Ref.2Nuclear export of Vpr is required for efficient replication of human immunodeficiency virus type 1 in tissue macrophages, Sherman et al., J. Virol., 2003} ^{Ref.1Nucleocytoplasmic shuttling by human immunodeficiency virus type 1 Vpr., Sherman et al., J. Virol., 2001}

Mutations That Affect CRM1 Binding

Unknown

Functional Export Signals

Undetermined

Secondary Structure of Export Signal

α-helix ^{Ref.3Functional and structural characterization of synthetic HIV-1 Vpr that transduces cells, localizes to the nucleus, and induces G2 cell cycle arrest, Henklein et al., J Biol Chem, 2000}

Other Residues Important for Export

Unknown

Sequence

Show FASTA Format

>gi|139386|sp|P05928.1|VPR_HV1BR RecName: Full=Protein Vpr; AltName: Full=R ORF protein; AltName: Full=Viral protein R
MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFI
HFRIGCRHSRIGVTQQRRARNGASRS

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 988988889987874052799999987888621553454201034677517516679999
Pred: CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCHHHHHHHH
  AA: MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAI
              10        20        30        40        50        60


Conf: 999999999998723444443220443300146899
Pred: HHHHHHHHHHHHHHCCCCCCCCCHHHHHHCCCCCCC
  AA: IRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS
              70        80        90

Show Conservation Score by AL2CO

1     M       2.322
2     E       0.818
3     Q      -0.025
4     A      -0.896
5     P       0.855
6     E      -0.626
7     D       0.270
8     Q       0.731
9     G       1.318
10    P       0.373
11    Q      -0.378
12    R       1.351
13    E      -0.361
14    P       0.266
15    H      -1.072
16    N      -1.434
17    E      -1.068
18    W       0.866
19    T      -0.832
20    L       0.721
21    E      -0.431
22    L      -0.854
23    L       0.423
24    E      -0.569
25    E      -0.569
26    L       0.310
27    K       1.428
28    N      -1.669
29    E      -0.349
30    A       0.333
31    V      -0.596
32    R      -0.052
33    H       1.516
34    F       0.828
35    P       0.862
36    R      -1.563
37    I      -2.038
38    W       0.866
39    L       0.784
40    H      -0.916
41    G      -0.925
42    L       0.719
43    G       0.720
44    Q      -0.836
45    H      -1.021
46    I       0.741
47    Y      -0.810
48    E      -1.702
49    T      -0.614
50    Y       1.399
51    G       0.282
52    D       0.764
53    T       0.385
54    W      -0.016
55    A      -1.515
56    G       1.503
57    V       0.937
58    E      -1.445
59    A      -0.623
60    I      -0.581
61    I      -0.693
62    R      -0.800
63    I      -1.235
64    L       0.899
65    Q      -0.326
66    Q       0.305
67    L       0.246
68    L       0.740
69    F       1.395
70    I      -0.354
71    H       0.875
72    F       0.313
73    R       0.781
74    I      -0.836
75    G       0.792
76    C       2.322
77    R      -1.064
78    H       1.486
79    S       0.925
80    R      -0.358
81    I       0.849
82    G       0.338
83    V      -0.819
84    T      -1.924
85    Q      -1.029
86    Q      -1.493
87    R      -0.435
88    R      -0.337
89    A      -1.547
90    R      -0.588
91    N      -0.321
92    G       0.819
93    A      -0.164
94    S      -0.138
95    R       0.746
96    S       2.322
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 86.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MEQAPEDQGP QREPHNEWTL ELLEELKNEA VRHFPRIWLH GLGQHIYETY GDTWAGVEAI 
        70         80         90                                  
IRILQQLLFI HFRIGCRHSR IGVTQQRRAR NGASRS

3D Structures in PDB

1BDE (NMR)
1DSJ (NMR)
1DSK (NMR)
1ESX (NMR)
1M8L (NMR)
1VPC (NMR)
1X9V (NMR)

Comments

HIV-1 Vpr is packaged into new virions and is suspected to be important for transport of the viral preintegration complex (PIC) through the nuclear pore complex. The minimal NES has not been mapped but mutations suggest that it is in the 2nd helix of Vpr (residues 60-71).

References

[1]. "Nucleocytoplasmic shuttling by human immunodeficiency virus type 1 Vpr."
Sherman MP, de Noronha CM, Heusch MI, Greene S, Greene WC. (2001) J. Virol., 75:1522-1532 PubMed
[2]. "Nuclear export of Vpr is required for efficient replication of human immunodeficiency virus type 1 in tissue macrophages"
Sherman MP, de Noronha CM, Eckstein LA, Hataye J, Mundt P, Williams SA, Neidleman JA, Goldsmith MA, Greene WC. (2003) J. Virol., 77:7582-7589 PubMed
[3]. "Functional and structural characterization of synthetic HIV-1 Vpr that transduces cells, localizes to the nucleus, and induces G2 cell cycle arrest"
Henklein P, Bruns K, Sherman MP, Tessmer U, Licha K, Kopp J, de Noronha CM, Greene WC, Wray V, Schubert U (2000) J Biol Chem, 275:32016-32026 PubMed

User Input

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©