NESdb

Protein X UniProt

pX , Peptide X

Hepatitis B virus genotype D subtype ayw (isolate France/Tiollais/1979) (HBV-D)

LMB Sensitive, Binds CRM1 ^{Ref.1Interaction of the hepatitis B virus X protein with the Crm1-dependent nuclear export pathway, Forgues et al., J Biol Chem, 2001}

*highlighted yellow in the full sequence

L98A/L100A ^{Ref.1Interaction of the hepatitis B virus X protein with the Crm1-dependent nuclear export pathway, Forgues et al., J Biol Chem, 2001}

Unknown

*shown as underlined residues in the full sequence

⁸⁷QILPKVLHKRTLGLSAM¹⁰³ ^{Ref.1Interaction of the hepatitis B virus X protein with the Crm1-dependent nuclear export pathway, Forgues et al., J Biol Chem, 2001}

Unknown

Show FASTA Format

>gi|139896|sp|P03165.2|X_HBVD3 RecName: Full=Protein X; AltName: Full=HBx; AltName: Full=Peptide X; AltName: Full=pX
MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPVCAFSSAGPCA
LRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHK
LVCAPAPCNFFTSA

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 954101001788604443104755689888768898889999986799974100059630
Pred: CCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCE
  AA: MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHGAHLSLRGLPV
              10        20        30        40        50        60


Conf: 120278720245401100000100001234565532024223433108888542000208
Pred: EEECCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHH
  AA: CAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGLSAMSTTDLEAYFKDCLFKDW
              70        80        90       100       110       120


Conf: 9760402467898638501035428888764269
Pred: HHHHHHEEEEEEEECCCCCCEEECCCCCCCCCCC
  AA: EELGEEIRLKVFVLGGCRHKLVCAPAPCNFFTSA
             130       140       150

Show Conservation Score by AL2CO

1     M       2.728
2     A       1.091
3     A       1.665
4     R       1.197
5     L       0.727
6     C      -0.423
7     C       1.197
8     Q       0.017
9     L       0.207
10    D       0.174
11    P      -1.183
12    A      -0.704
13    R       1.050
14    D      -0.335
15    V       1.186
16    L       0.985
17    C      -0.021
18    L       1.176
19    R       1.855
20    P       2.728
21    V      -0.363
22    G      -0.604
23    A      -0.981
24    E       0.920
25    S       1.490
26    R      -0.138
27    G       0.660
28    R       0.971
29    P       0.389
30    F      -0.417
31    S      -0.867
32    G       0.920
33    S      -0.378
34    L      -0.569
35    G       0.240
36    T      -1.125
37    L      -1.398
38    S      -0.721
39    S      -0.411
40    P      -0.426
41    S      -0.491
42    P      -0.774
43    S       0.332
44    A      -1.110
45    V      -0.282
46    P       0.387
47    T      -0.485
48    D      -1.202
49    H       0.145
50    G       0.391
51    A      -0.363
52    H       0.434
53    L       0.548
54    S       0.037
55    L       1.030
56    R       0.476
57    G       0.319
58    L       1.754
59    P       1.887
60    V      -0.397
61    C       1.891
62    A       0.028
63    F       0.099
64    S       1.699
65    S      -0.305
66    A       0.610
67    G       0.691
68    P       1.219
69    C       1.052
70    A      -0.266
71    L       0.319
72    R      -0.829
73    F       0.271
74    T       0.915
75    S       0.241
76    A       0.915
77    R      -0.625
78    R      -1.209
79    M       0.510
80    E      -0.466
81    T       1.084
82    T       0.069
83    V      -0.002
84    N       0.590
85    A      -1.405
86    H      -1.189
87    Q      -1.275
88    I      -1.845
89    L       0.011
90    P      -0.929
91    K      -0.799
92    V      -1.815
93    L      -0.190
94    H      -0.477
95    K      -0.406
96    R       0.341
97    T      -0.609
98    L      -0.872
99    G       0.286
100   L      -0.036
101   S      -1.280
102   A      -1.666
103   M      -0.960
104   S      -0.884
105   T      -1.141
106   T      -1.165
107   D      -1.826
108   L      -1.019
109   E      -1.277
110   A      -1.836
111   Y       0.040
112   F      -0.621
113   K      -0.025
114   D      -0.761
115   C      -0.808
116   L      -0.348
117   F      -0.518
118   K      -1.256
119   D      -1.495
120   W       0.518
121   E      -0.183
122   E       0.257
123   L      -1.424
124   G       0.226
125   E      -1.247
126   E      -0.214
127   I      -2.025
128   R       0.338
129   L       0.747
130   K      -1.381
131   V      -0.710
132   F      -0.316
133   V       0.180
134   L       0.861
135   G       0.604
136   G       1.225
137   C       0.584
138   R       0.260
139   H       1.861
140   K       1.078
141   L       1.054
142   V      -0.136
143   C      -0.088
144   A      -1.084
145   P      -0.903
146   A      -0.767
147   P      -0.384
148   C      -0.385
149   N      -0.333
150   F       1.729
151   F       1.603
152   T       0.442
153   S       2.728
154   A       1.692
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 89.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MAARLCCQLD PARDVLCLRP VGAESRGRPF SGSLGTLSSP SPSAVPTDHG AHLSLRGLPV 
        70         80         90        100        110        120 
CAFSSAGPCA LRFTSARRME TTVNAHQILP KVLHKRTLGL SAMSTTDLEA YFKDCLFKDW 
       130        140        150                                  EELGEEIRLK VFVLGGCRHK LVCAPAPCNF FTSA

Not Available

The oncogenicity of hepatitis B virus is largely the result of HBz, whose major cellular function is its promiscuous transcriptional activation activity. The NES of HBx is located in the center region and has been shown to be necessary for HBx-induced cytoplasmic retention of CRM1, and subsequently, the nuclear translocation and activation of NFκB.

[1]. "Interaction of the hepatitis B virus X protein with the Crm1-dependent nuclear export pathway"
Forgues M, Marrogi AJ, Spillare EA, Wu CG, Yang Q, Yoshida M, Wang XW. (2001) J Biol Chem, 276:22797-22803 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©