NESdb

Calcineurin B homologous protein 1 UniProt

Calcium-binding protein p22, Calcineurin B homolog,

Homo sapiens (Human)

LMB Sensitive ^{Ref.1Two nuclear export signals specify the cytoplasmic localization of calcineurin B homologous protein 1., Nagita et al., J Biol Chem, 2003}

*highlighted yellow in the full sequence

V143A/V145A/I147A/V183A/V185A, V138A/L139A/V179A/L180A ^{Ref.1Two nuclear export signals specify the cytoplasmic localization of calcineurin B homologous protein 1., Nagita et al., J Biol Chem, 2003}

Unknown

*shown as underlined residues in the full sequence

¹³⁸VLRMMVGVNI¹⁴⁷, ¹⁷⁶FVKVLEKVDV¹⁸⁵ ^{Ref.1Two nuclear export signals specify the cytoplasmic localization of calcineurin B homologous protein 1., Nagita et al., J Biol Chem, 2003}

Unknown

Show FASTA Format

>gi|3023439|sp|Q99653.3|CHP1_HUMAN RecName: Full=Calcium-binding protein p22; AltName: Full=Calcineurin B homolog; AltName: Full=Calcineurin homologous protein; AltName: Full=Calcium-binding protein CHP
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAF
FPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR
MMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH

Show Domain Info by CDD

Show Secondary Structure by PSIPRED

    	# PSIPRED HFORMAT (PSIPRED V3.2)

Conf: 998647899958899999854999998999998612208999995187762688111109
Pred: CCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHHCCCCHHHCC
  AA: MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
              10        20        30        40        50        60


Conf: 635667453078888742327899872343665467778899999998521143220100
Pred: CHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEE
  AA: PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
              70        80        90       100       110       120


Conf: 443799998267899999999528999998995899999995526899970699999975
Pred: CCCCCCCCCCCHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHH
  AA: LYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
             130       140       150       160       170       180


Conf: 058976147997139
Pred: HCCCCCCEEEEEECC
  AA: EKVDVEQKMSIRFLH
             190

Show Conservation Score by AL2CO

1     M       3.912
2     G       3.507
3     S      -0.374
4     R      -1.150
5     A      -1.127
6     S       0.421
7     T      -0.776
8     L      -1.106
9     L      -0.831
10    R      -0.879
11    D      -0.891
12    E      -0.189
13    E      -0.441
14    L      -0.549
15    E      -0.700
16    E      -0.754
17    I       0.565
18    K      -0.528
19    K      -0.678
20    E      -1.087
21    T       0.824
22    G      -1.003
23    F       1.963
24    S       0.417
25    H      -0.924
26    S      -0.771
27    Q       0.406
28    I       1.457
29    T      -0.976
30    R      -0.438
31    L       0.950
32    Y      -0.336
33    S      -0.622
34    R       0.690
35    F       2.881
36    T      -0.875
37    S      -0.830
38    L       0.997
39    D       0.273
40    K      -1.058
41    G      -0.728
42    E      -0.760
43    N      -0.737
44    G      -0.145
45    T      -0.928
46    L       1.290
47    S      -0.474
48    R      -1.014
49    E      -0.591
50    D      -0.255
51    F       1.104
52    Q      -1.142
53    R      -0.835
54    I       0.355
55    P      -0.432
56    E      -0.739
57    L      -0.342
58    A      -0.785
59    I      -1.181
60    N       1.322
61    P       0.509
62    L       1.285
63    G      -0.144
64    D      -0.614
65    R       0.797
66    I       1.122
67    I       0.148
68    N      -0.630
69    A      -0.042
70    F       0.973
71    F       0.418
72    P      -1.130
73    E      -0.416
74    G      -0.519
75    E      -0.525
76    D      -0.223
77    Q      -1.097
78    V       0.762
79    N      -0.032
80    F       2.869
81    R      -0.882
82    G       0.212
83    F       2.400
84    M       0.601
85    R      -1.027
86    T      -0.291
87    L       0.469
88    A       0.308
89    H      -0.653
90    F       1.324
91    R      -0.049
92    P      -0.299
93    I      -1.232
94    E      -0.220
95    D      -0.469
96    N      -1.000    *
97    E      -1.000    *
98    K      -1.000    *
99    S      -1.000    *
100   K      -1.000    *
101   D      -1.000    *
102   V      -1.000    *
103   N      -1.000    *
104   G      -1.000    *
105   P      -1.000    *
106   E      -1.000    *
107   P      -1.000    *
108   L      -1.000    *
109   N      -1.000    *
110   S      -0.636
111   R      -0.598
112   S      -0.832
113   N      -0.612
114   K       1.425
115   L       0.371
116   H      -1.000
117   F       0.393
118   A       0.360
119   F       2.237
120   R      -0.307
121   L       0.870
122   Y       1.536
123   D       2.817
124   L      -0.340
125   D       0.309
126   K      -0.667
127   D       0.695
128   E       0.357
129   K      -0.609
130   I       1.534
131   S       0.088
132   R      -0.965
133   D      -0.875
134   E       2.305
135   L       0.884
136   L      -0.787
137   Q      -0.873
138   V       0.385
139   L       0.994
140   R      -0.945
141   M      -0.536
142   M       0.783
143   V       0.083
144   G      -0.643
145   V      -1.030
146   N      -0.818
147   I       0.273
148   S      -0.549
149   D      -0.540
150   E      -0.808
151   Q      -0.752
152   L       0.438
153   G      -0.706
154   S      -0.973
155   I       0.782
156   A       0.415
157   D      -0.252
158   R       0.066
159   T       0.600
160   I       0.873
161   Q      -0.898
162   E      -0.528
163   A       0.307
164   D       1.393
165   Q      -1.107
166   D       0.356
167   G      -0.911
168   D       0.671
169   S      -0.186
170   A      -0.626
171   I       1.549
172   S       0.177
173   F      -0.349
174   T      -0.699
175   E       1.840
176   F       2.377
177   V      -0.753
178   K      -0.848
179   V      -0.136
180   L       0.064
181   E      -0.690
182   K      -0.623
183   V      -0.703
184   D      -0.269
185   V       0.219
186   E      -0.928
187   Q      -0.693
188   K      -0.489
189   M       1.118
190   S      -0.176
191   I       1.253
192   R      -0.464
193   F       0.471
194   L      -1.000    *
195   H      -1.000    *
* gap fraction no less than  0.50; conservation set to M-S
  M: mean;  S: standard deviation

al2co - The parameters are:

Input alignment file - 96.paln
Output conservation - STDOUT
Weighting scheme - independent-count based
Conservation calculation method - entropy-based
Window size - 1
Conservation normalized to zero mean and unity variance
Gap fraction to suppress calculation -  0.50

        10         20         30         40         50         60 MGSRASTLLR DEELEEIKKE TGFSHSQITR LYSRFTSLDK GENGTLSRED FQRIPELAIN 
        70         80         90        100        110        120 PLGDRIINAF FPEGEDQVNF RGFMRTLAHF RPIEDNEKSK DVNGPEPLNS RSNKLHFAFR 
       130        140        150        160        170        180 
LYDLDKDEKI SRDELLQVLR MMVGVNISDE QLGSIADRTI QEADQDGDSA ISFTEFVKVL 
       190                                                        
EKVDVEQKMS IRFLH

2CT9 (X-Ray,2.20 Å resolution)

CHP1 is a member of the samll calcium-binding proteins with an EF-hand motif. CHP1 is usually located in the cytoplasm. It can translocate to the nucleus upon overexpression of DRAK2. Nagita et al. showed that the two putative NESs at the C-terminus help to return CHP1 to the cytoplasm.
Doubt about NES: The C-terminal NES failed to bind CRM1 in GST-pulldown assay.

[1]. "Two nuclear export signals specify the cytoplasmic localization of calcineurin B homologous protein 1."
Nagita M, Inoue H, Nakamura N, Kanazawa H. (2003) J Biol Chem, 134:919-25 PubMed

Accurate identification of NESs is difficult because many sequences in the genome match the NES consensus. Therefore, some published NESs may be mistakenly identified. Please help us improve the accuracy of NESdb by providing either a positive or negative flag for the NES in this entry. Supporting comments are required to process the flag.

NESdb©