MESSA Job ID: 7108939


Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410
MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccccHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccc
ccHHcccccccccccccccccccccccccccHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHcccccccHHHHcccEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccccccc
mgerffrnempefvpedlsgeeetVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWErsgkrvrdynlyTGVLGTAYLLFKSYQVTRNEDDLKLCLENveacdvasrdseRVTFICGYAGVCALGAVAAkclgddqlYDRYLARFrgirlpsdlpyellygRAGYLWACLFLNkhigqesissERMRSVVEEIFRAGRqlgnkgtcplmyewhgkrywgaahGLAGIMNVLMhtelepdeikdVKGTLSYMIQnrfpsgnylssegsksdrlvhwchgaPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVgichgisgnTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISegqmhggdrpfslfegigGMAYmlldmndptqalfpgyel
mgerffrnempefvpedlsgeeETVTECKDSLTKLLSLPYKSFSEKLHRYalsikdkvvwetwersgkrvrdynlyTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEacdvasrdsERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFragrqlgnkgTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISegqmhggdrPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
*GERFFRNEMPEFVPED*************SLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
********EMPEFVPE**************SLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
*****FRNEMPEFVP************CKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL

Close Homologs For Annotation Transfering and Analysis of Evolutionary History

Close Homologs in SWISS-PROT Database Detected by BLAST

SP IDAlignment graphLength Definition FW blast BW blast Q cover H cover Identity E-value
Target410
Q9JJK2450 LanC-like protein 2 OS=Mu yes yes 0.978 0.891 0.394 2e-71
Q9NS86450 LanC-like protein 2 OS=Ho yes yes 0.978 0.891 0.388 3e-70
Q90ZL2405 LanC-like protein 1 OS=Da no no 0.804 0.814 0.397 4e-63
O89112399 LanC-like protein 1 OS=Mu no no 0.856 0.879 0.388 2e-62
O43813399 LanC-like protein 1 OS=Ho no no 0.853 0.877 0.391 2e-62
Q9QX69399 LanC-like protein 1 OS=Ra no no 0.856 0.879 0.391 8e-62
Q9Y0Y7419 LanC-like protein 3 homol yes yes 0.926 0.906 0.314 6e-55
Q29HZ1420 LanC-like protein 3 homol no yes 0.8 0.780 0.320 4e-50
Q6ZV70420 LanC-like protein 3 OS=Ho no yes 0.790 0.771 0.358 8e-50
Q8CD19420 LanC-like protein 3 OS=Mu no no 0.797 0.778 0.347 1e-48
>sp|Q9JJK2|LANC2_MOUSE LanC-like protein 2 OS=Mus musculus GN=Lancl2 PE=1 SV=1 Back     alignment and organism information
 Score =  269 bits (688), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 172/436 (39%), Positives = 242/436 (55%), Gaps = 35/436 (8%)

Query: 1   MGERFFRNEMPEF------VPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSI 54
           M ER F N  P++              EET   C    T+   LP+    + +  +   I
Sbjct: 18  MEERSFPNPFPDYEAAASAAGLAAGSAEETGRVCPLPTTEDPGLPFHPNGKIVPNFIKRI 77

Query: 55  KDKV--VWETWERSGKRV--RDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACD 110
           + K+  + +  E   K     D + YTG  G A L  + Y+VT ++  L   L+ V+   
Sbjct: 78  QTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVKR-T 136

Query: 111 VASRDSERVTFICGYAGVCALGAVAAKCLGDD----QLYDRYLARFRGIRLP-SDLPYEL 165
           + +    RVTF+CG AG  A+GAV    L  +    +   + L   R I    S+LP EL
Sbjct: 137 LRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDEL 196

Query: 166 LYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGT----CPLMYEWHG 221
           LYGRAGYL+A L+LN  IG  ++    ++ VV  I  +G+ L  +      CPL+Y+WH 
Sbjct: 197 LYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLLYQWHR 256

Query: 222 KRYWGAAHGLAGIMNVLMHTELEPDE---IKDVKGTLSYMIQNRFPSGNYLSSEGSKSDR 278
           K+Y GAAHG+AGI  +LM  E + D+    + VK ++ Y+   +F SGNY SS  +++DR
Sbjct: 257 KQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDR 316

Query: 279 LVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKR-VGICHGISGNTYV 337
           LVHWCHGAPGV   L++A QV+  +++++ AME  +V+W RGLL++  GICHG SGN Y 
Sbjct: 317 LVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTSGNGYS 376

Query: 338 FLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHG---GDRPFSLFEGIGGMAYML 394
           FLSLYRLT++ KYLYRA  FA + LD           HG    DRP+SLFEG+ G  + L
Sbjct: 377 FLSLYRLTQDKKYLYRACKFAEWCLDYG--------AHGCRIPDRPYSLFEGMAGAVHFL 428

Query: 395 LDMNDPTQALFPGYEL 410
            D+  P  A FP +EL
Sbjct: 429 SDILVPETARFPAFEL 444




Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.
Mus musculus (taxid: 10090)
>sp|Q9NS86|LANC2_HUMAN LanC-like protein 2 OS=Homo sapiens GN=LANCL2 PE=1 SV=1 Back     alignment and organism information
>sp|Q90ZL2|LANC1_DANRE LanC-like protein 1 OS=Danio rerio GN=lancl1 PE=2 SV=1 Back     alignment and organism information
>sp|O89112|LANC1_MOUSE LanC-like protein 1 OS=Mus musculus GN=Lancl1 PE=1 SV=1 Back     alignment and organism information
>sp|O43813|LANC1_HUMAN LanC-like protein 1 OS=Homo sapiens GN=LANCL1 PE=1 SV=1 Back     alignment and organism information
>sp|Q9QX69|LANC1_RAT LanC-like protein 1 OS=Rattus norvegicus GN=Lancl1 PE=2 SV=2 Back     alignment and organism information
>sp|Q9Y0Y7|LANC3_DROME LanC-like protein 3 homolog OS=Drosophila melanogaster GN=CG2061 PE=1 SV=1 Back     alignment and organism information
>sp|Q29HZ1|LANC3_DROPS LanC-like protein 3 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA15215 PE=3 SV=1 Back     alignment and organism information
>sp|Q6ZV70|LANC3_HUMAN LanC-like protein 3 OS=Homo sapiens GN=LANCL3 PE=2 SV=2 Back     alignment and organism information
>sp|Q8CD19|LANC3_MOUSE LanC-like protein 3 OS=Mus musculus GN=Lancl3 PE=2 SV=2 Back     alignment and organism information

Close Homologs in Nonredundant Database Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target410
145336679410 G protein coupled receptor [Arabidopsis thaliana] gi|33 0.0
12324628401 putative G protein-coupled receptor; 80093-78432 [Arabi 0.0
297853060410 predicted protein [Arabidopsis lyrata subsp. lyrata] gi 0.0
224128201417 predicted protein [Populus trichocarpa] gi|222869775|gb 0.0
225461385407 PREDICTED: lanC-like protein 2 [Vitis vinifera] gi|3021 0.0
356544018405 PREDICTED: lanC-like protein 2-like [Glycine max] 0.0
255587364419 catalytic, putative [Ricinus communis] gi|223525647|gb| 0.0
356542916414 PREDICTED: lanC-like protein 2-like [Glycine max] 0.0
146233385443 abscisic acid ABA receptor [Populus trichocarpa] 0.0
297832678405 hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyr 0.0
>gi|145336679|ref|NP_175700.2| G protein coupled receptor [Arabidopsis thaliana] gi|332194747|gb|AEE32868.1| G protein coupled receptor [Arabidopsis thaliana] Back     alignment and organism information
 Score =  850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/410 (100%), Positives = 410/410 (100%), Gaps = 0/410 (0%)

Query  1    MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVW  60
            MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVW
Sbjct  1    MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVW  60

Query  61   ETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVT  120
            ETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVT
Sbjct  61   ETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVT  120

Query  121  FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLN  180
            FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLN
Sbjct  121  FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLN  180

Query  181  KHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMH  240
            KHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMH
Sbjct  181  KHIGQESISSERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMH  240

Query  241  TELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY  300
            TELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY
Sbjct  241  TELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVY  300

Query  301  NTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASF  360
            NTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASF
Sbjct  301  NTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASF  360

Query  361  LLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  410
            LLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
Sbjct  361  LLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  410




Source: Arabidopsis thaliana

Species: Arabidopsis thaliana

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|12324628|gb|AAG52264.1|AC019018_1 putative G protein-coupled receptor; 80093-78432 [Arabidopsis thaliana] Back     alignment and organism information
>gi|297853060|ref|XP_002894411.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297340253|gb|EFH70670.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and organism information
>gi|224128201|ref|XP_002329106.1| predicted protein [Populus trichocarpa] gi|222869775|gb|EEF06906.1| predicted protein [Populus trichocarpa] Back     alignment and organism information
>gi|225461385|ref|XP_002284781.1| PREDICTED: lanC-like protein 2 [Vitis vinifera] gi|302143043|emb|CBI20338.3| unnamed protein product [Vitis vinifera] Back     alignment and organism information
>gi|356544018|ref|XP_003540453.1| PREDICTED: lanC-like protein 2-like [Glycine max] Back     alignment and organism information
>gi|255587364|ref|XP_002534246.1| catalytic, putative [Ricinus communis] gi|223525647|gb|EEF28136.1| catalytic, putative [Ricinus communis] Back     alignment and organism information
>gi|356542916|ref|XP_003539910.1| PREDICTED: lanC-like protein 2-like [Glycine max] Back     alignment and organism information
>gi|146233385|gb|ABQ14360.1| abscisic acid ABA receptor [Populus trichocarpa] Back     alignment and organism information
>gi|297832678|ref|XP_002884221.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. lyrata] gi|297330061|gb|EFH60480.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. lyrata] Back     alignment and organism information

Prediction of Gene Ontology terms

Close Homologs with Gene Ontology terms Detected by BLAST

GO IDAlignment graphLength Definition Q-cover H-cover Identity E-value
Target410
TAIR|locus:2011466401 GPCR "G protein coupled recept 0.978 1.0 1.0 4.4e-220
TAIR|locus:2051449405 GCL2 "GCR2-like 2" [Arabidopsi 1.002 1.014 0.639 4.3e-142
TAIR|locus:2171800433 GCL1 "GCR2-like 1" [Arabidopsi 0.868 0.822 0.469 5.9e-83
MGI|MGI:1919085450 Lancl2 "LanC (bacterial lantib 0.990 0.902 0.406 2.5e-68
UNIPROTKB|A6QPG6433 LANCL2 "Uncharacterized protei 1.043 0.988 0.385 1.1e-67
ZFIN|ZDB-GENE-070209-191435 zgc:158293 "zgc:158293" [Danio 1.036 0.977 0.383 1.1e-67
UNIPROTKB|Q9NS86450 LANCL2 "LanC-like protein 2" [ 0.990 0.902 0.399 1.4e-67
RGD|1310809450 Lancl2 "LanC lantibiotic synth 0.995 0.906 0.406 1.7e-67
UNIPROTKB|E1C3R4455 LANCL2 "Uncharacterized protei 0.951 0.857 0.382 5.3e-66
UNIPROTKB|I3LIW1412 LANCL2 "Uncharacterized protei 0.929 0.924 0.409 1.4e-65
TAIR|locus:2011466 GPCR "G protein coupled receptor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and organism information
 Score = 2125 (753.1 bits), Expect = 4.4e-220, P = 4.4e-220
 Identities = 401/401 (100%), Positives = 401/401 (100%)

Query:    10 MPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKR 69
             MPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKR
Sbjct:     1 MPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGKR 60

Query:    70 VRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVC 129
             VRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVC
Sbjct:    61 VRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVC 120

Query:   130 ALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESIS 189
             ALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESIS
Sbjct:   121 ALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQESIS 180

Query:   190 SERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIK 249
             SERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIK
Sbjct:   181 SERMRSVVEEIFRAGRQLGNKGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEPDEIK 240

Query:   250 DVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAA 309
             DVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAA
Sbjct:   241 DVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAA 300

Query:   310 MEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLI 369
             MEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLI
Sbjct:   301 MEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLI 360

Query:   370 SEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL 410
             SEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL
Sbjct:   361 SEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL 401




GO:0003824 "catalytic activity" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=IDA
GO:0009787 "regulation of abscisic acid mediated signaling pathway" evidence=IMP
GO:0010231 "maintenance of seed dormancy" evidence=IMP
GO:0010427 "abscisic acid binding" evidence=IDA
GO:0019898 "extrinsic to membrane" evidence=ISS
TAIR|locus:2051449 GCL2 "GCR2-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and organism information
TAIR|locus:2171800 GCL1 "GCR2-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and organism information
MGI|MGI:1919085 Lancl2 "LanC (bacterial lantibiotic synthetase component C)-like 2" [Mus musculus (taxid:10090)] Back     alignment and organism information
UNIPROTKB|A6QPG6 LANCL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and organism information
ZFIN|ZDB-GENE-070209-191 zgc:158293 "zgc:158293" [Danio rerio (taxid:7955)] Back     alignment and organism information
UNIPROTKB|Q9NS86 LANCL2 "LanC-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and organism information
RGD|1310809 Lancl2 "LanC lantibiotic synthetase component C-like 2 (bacterial)" [Rattus norvegicus (taxid:10116)] Back     alignment and organism information
UNIPROTKB|E1C3R4 LANCL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and organism information
UNIPROTKB|I3LIW1 LANCL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and organism information

Gene Ontology terms Predicted by CombFunc Server

Fail to connect to CombFunc Server


Prediction of Enzyme Classification Number

Close homologs (Orthologs) in SWISSPROT detected by BLAST for EC number transfering

SWISSPROT IDAnnotated EC numberIdentity to QueryQuery coverageHit coverageReciprocal Blast(Forward)Reciprocal Blast(Backward)
Q9NS86No assigned EC number0.38850.97800.8911yesyes
Q9JJK2No assigned EC number0.39440.97800.8911yesyes
Q9Y0Y7No assigned EC number0.31430.92680.9069yesyes

Enzyme Classification number predicted by Ezypred Server

1st Layeris an Enzyme protein
2nd Layer2.-.-.- Transferases
3rd Layer2.8.-.- Transferring sulfur-containing groups

Enzyme Classification number predicted by EFICAZ software package

No EC number assignment, probably not an enzyme!


Genomic Context and Functionally Associated Proteins

View genomic context of your protein in NCBI

Functionally associated proteins dectected by STRING server

Your Input:
GPCR
GPCR (G PROTEIN COUPLED RECEPTOR); abscisic acid binding / catalytic (410 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
GPA1
GP ALPHA 1 (G PROTEIN ALPHA SUBUNIT 1); GTP binding / GTPase/ channel regulator/ signal transdu [...] (383 aa)
       0.863

Related Conserved Domains and ProteinFamilies

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target410
KOG2787403 KOG2787, KOG2787, KOG2787, Lanthionine synthetase C-lik 1e-173
cd04794343 cd04794, euk_LANCL, eukaryotic Lanthionine synthetase C 1e-100
pfam05147350 pfam05147, LANC_like, Lanthionine synthetase C-like pro 6e-93
cd04434343 cd04434, LanC_like, LanC-like proteins 3e-55
COG4403963 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense 1e-07
COG4403 963 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense 0.004
>gnl|CDD|37998 KOG2787, KOG2787, KOG2787, Lanthionine synthetase C-like protein 1 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|88611 cd04794, euk_LANCL, eukaryotic Lanthionine synthetase C-like protein Back     alignment and domain information
>gnl|CDD|147364 pfam05147, LANC_like, Lanthionine synthetase C-like protein Back     alignment and domain information
>gnl|CDD|88607 cd04434, LanC_like, LanC-like proteins Back     alignment and domain information
>gnl|CDD|34109 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|34109 COG4403, LcnDR2, Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 410
KOG2787403 consensus 100.0
cd04794343 euk_LANCL eukaryotic Lanthionine synthetase C-like prot 100.0
cd04792825 LanM-like LanM-like proteins. LanM is a bifunctional en 100.0
cd04434343 LanC_like LanC-like proteins. LanC is the cyclase enzym 100.0
COG4403963 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms 100.0
cd04434343 LanC_like LanC-like proteins. LanC is the cyclase enzym 99.82
cd04791321 LanC_SerThrkinase Lanthionine synthetase C-like domain 99.79
cd04794343 euk_LANCL eukaryotic Lanthionine synthetase C-like prot 99.7
cd04792825 LanM-like LanM-like proteins. LanM is a bifunctional en 99.8
COG4403963 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms 99.45
COG4225357 Predicted unsaturated glucuronyl hydrolase involved in 96.76
COG1331667 Highly conserved protein containing a thioredoxin domai 96.51
COG1331667 Highly conserved protein containing a thioredoxin domai 95.4
COG3533 589 Uncharacterized protein conserved in bacteria [Function 92.53
cd00249 384 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain 91.68
TIGR02474290 pec_lyase pectate lyase, PelA/Pel-15E family. Members o 87.6
PTZ00470 522 glycoside hydrolase family 47 protein; Provisional 89.34
COG3533589 Uncharacterized protein conserved in bacteria [Function 85.07
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in class II 84.35
cd02889348 SQCY Squalene cyclase (SQCY) domain; found in class II 81.38
>KOG2787 consensus Back     alignment and domain information
>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein Back     alignment and domain information
>cd04792 LanM-like LanM-like proteins Back     alignment and domain information
>cd04434 LanC_like LanC-like proteins Back     alignment and domain information
>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information
>cd04434 LanC_like LanC-like proteins Back     alignment and domain information
>cd04791 LanC_SerThrkinase Lanthionine synthetase C-like domain associated with serine threonine kinases Back     alignment and domain information
>cd04794 euk_LANCL eukaryotic Lanthionine synthetase C-like protein Back     alignment and domain information
>cd04792 LanM-like LanM-like proteins Back     alignment and domain information
>COG4403 LcnDR2 Lantibiotic modifying enzyme [Defense mechanisms] Back     alignment and domain information
>COG4225 Predicted unsaturated glucuronyl hydrolase involved in regulation of bacterial surface properties, and related proteins [General function prediction only] Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3533 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00249 AGE AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid Back     alignment and domain information
>TIGR02474 pec_lyase pectate lyase, PelA/Pel-15E family Back     alignment and domain information
>PTZ00470 glycoside hydrolase family 47 protein; Provisional Back     alignment and domain information
>COG3533 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information
>cd02889 SQCY Squalene cyclase (SQCY) domain; found in class II terpene cyclases that have an alpha 6 - alpha 6 barrel fold Back     alignment and domain information

Homologous Structures in Protein Data Bank

Homologous Structures Detected by BLAST against Protein Data Bank

IdentityAlignment graphLength Definition E-value
Target410
3e6u_A411 Crystal Structure Of Human Lancl1 Length = 411 1e-63
2g02_A409 Nisin Cyclase Length = 409 4e-04
>pdb|3E6U|A Chain A, Crystal Structure Of Human Lancl1 Length = 411 Back     alignment and structure

Iteration: 1

Score = 240 bits (612), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 146/373 (39%), Positives = 206/373 (55%), Gaps = 23/373 (6%) Query: 52 LSIKDKVVWETWERSGKRV--RDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEAC 109 L+ K + + + ER K RD YTG G A L Y V + L+L V+ Sbjct: 48 LTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQ- 106 Query: 110 DVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGI-RLPSDLPYELLYG 168 + +TF+CG AG A+ AV + +++ + + R + ++ P E+LYG Sbjct: 107 SLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYG 166 Query: 169 RAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNK----GTCPLMYEWHGKRY 224 R GY++A LF+NK+ G E I ++ + E I +G L K PLMYEW+ + Y Sbjct: 167 RIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYY 226 Query: 225 WGAAHGLAGIMNVLMHTELEPDEIKD---VKGTLSYMIQNRFPSGNYLSSEGSKSDRLVH 281 GAAHGLAGI LM L+ + K VK ++ Y+ Q +FPSGNY G D LVH Sbjct: 227 VGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVH 286 Query: 282 WCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKR-VGICHGISGNTYVFLS 340 WCHGAPGV L++A +V+ ++++ A + +V+W GLLK+ G+CHG +GN Y FL+ Sbjct: 287 WCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLT 346 Query: 341 LYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHG---GDRPFSLFEGIGGMAYMLLDM 397 LY LT++ KYLYRA FA + L+ E HG D PFSLFEG+ G Y L D+ Sbjct: 347 LYNLTQDMKYLYRACKFAEWCLEYGE--------HGCRTPDTPFSLFEGMAGTIYFLADL 398 Query: 398 NDPTQALFPGYEL 410 PT+A FP +EL Sbjct: 399 LVPTKARFPAFEL 411
>pdb|2G02|A Chain A, Nisin Cyclase Length = 409 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target410
3e6u_A411 LANC-like protein 1; alpha barrel, cytoplasm, signaling 4e-85
2g0d_A409 Nisin biosynthesis protein NISC; alpha toroid, alpha ba 6e-49
>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Length = 411 Back     alignment and structure
 Score =  310 bits (794), Expect = 4e-85
 Identities = 145/419 (34%), Positives = 211/419 (50%), Gaps = 29/419 (6%)

Query: 1   MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVW 60
           M +R F N   ++      G  +         ++ L+   +   +++ R           
Sbjct: 13  MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERG---------- 62

Query: 61  ETWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVT 120
                     RD   YTG  G A L    Y V  +   L+L    V+   +       +T
Sbjct: 63  ----LKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQS-LNCLTKRSIT 117

Query: 121 FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGI-RLPSDLPYELLYGRAGYLWACLFL 179
           F+CG AG  A+ AV    + +++  +  + R   + ++    P E+LYGR GY++A LF+
Sbjct: 118 FLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFV 177

Query: 180 NKHIGQESISSERMRSVVEEIFRAGRQLGNK----GTCPLMYEWHGKRYWGAAHGLAGIM 235
           NK+ G E I    ++ + E I  +G  L  K       PLMYEW+ + Y GAAHGLAGI 
Sbjct: 178 NKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIY 237

Query: 236 NVLMHTEL---EPDEIKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALT 292
             LM   L   +      VK ++ Y+ Q +FPSGNY    G   D LVHWCHGAPGV   
Sbjct: 238 YYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYM 297

Query: 293 LVKAAQVYNTKEFVEAAMEAGEVVWSRGLLKR-VGICHGISGNTYVFLSLYRLTRNPKYL 351
           L++A +V+  ++++  A +  +V+W  GLLK+  G+CHG +GN Y FL+LY LT++ KYL
Sbjct: 298 LIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYL 357

Query: 352 YRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL 410
           YRA  FA + L+       E      D PFSLFEG+ G  Y L D+  PT+A FP +EL
Sbjct: 358 YRACKFAEWCLEY-----GEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL 411


>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A Length = 409 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

PDB IDAlignment graphLength Definition Probability
Target410
3e6u_A411 LANC-like protein 1; alpha barrel, cytoplasm, signaling 100.0
2g0d_A409 Nisin biosynthesis protein NISC; alpha toroid, alpha ba 100.0
3e6u_A411 LANC-like protein 1; alpha barrel, cytoplasm, signaling 99.92
2g0d_A409 Nisin biosynthesis protein NISC; alpha toroid, alpha ba 99.81
2ahf_A377 Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, 98.11
2zzr_A397 Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A { 97.91
3gt5_A402 N-acetylglucosamine 2-epimerase; structural genomics, i 96.8
2zzr_A397 Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A { 97.96
1nc5_A373 Hypothetical protein YTER; structural genomics, helix b 96.86
3k11_A445 Putative glycosyl hydrolase; structural genomics, joint 85.1
3pmm_A382 Putative cytoplasmic protein; structural genomics, PSI- 97.94
3k7x_A349 LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomi 97.57
1nc5_A373 Hypothetical protein YTER; structural genomics, helix b 96.9
3pmm_A382 Putative cytoplasmic protein; structural genomics, PSI- 97.93
2ahf_A377 Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, 97.71
3gt5_A402 N-acetylglucosamine 2-epimerase; structural genomics, i 97.17
3k11_A445 Putative glycosyl hydrolase; structural genomics, joint 90.92
2gz6_A388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, i 97.61
1fp3_A402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, i 96.03
3k7x_A349 LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomi 97.15
2zbl_A421 Putative isomerase; N-acyl-D-glucosamine 2-epimerase pr 92.83
1fp3_A402 N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, i 89.52
2gz6_A 388 N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, i 95.17
1gxm_A332 Pectate lyase; mechanism, elimination; 1.32A {Cellvibri 91.32
1r76_A408 Pectate lyase; A-helical structure; 2.65A {Azospirillum 90.35
1x9d_A 538 Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alp 87.45
>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Back     alignment and structure
Probab=100.00  E-value=5.3e-66  Score=517.57  Aligned_cols=386  Identities=37%  Similarity=0.649  Sum_probs=0.0

Q ss_pred             CCCccCCCCCCccccccccccccccccchhhhhhhcccccchhhHH----HHHHHHHHHHHHHHhhccccCCCCCCCCee
Q 7108939           1 MGERFFRNEMPEFVPEDLSGEEETVTECKDSLTKLLSLPYKSFSEK----LHRYALSIKDKVVWETWERSGKRVRDYNLY   76 (410)
Q Consensus         1 ~~~r~~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~l~~a~~i~~~l~~~~w~~~~~~~~~~~Ly   76 (410)
                      |++|||+|||+||+++...+.+.               +.+++.++    +.+.+.++.+.+.+..|...   +.+.+||
T Consensus        13 ~~~r~~~n~~~~~~~~~~~~~~~---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~ly   74 (411)
T 3e6u_A           13 MAQRAFPNPYADYNKSLAEGYFD---------------AAGRLTPEFSQRLTNKIRELLQQMERGLKSAD---PRDGTGY   74 (411)
T ss_dssp             GGGGBCCCCSCCCCHHHHHTTBC---------------TTCCBCHHHHHHHHHHHHHHHHHHHHHTTTSC---TTCCCSS
T ss_pred             ccCCcCCCCCCCccccccccccc---------------ccCcccHHHHHHHHHHHHHHHHHHHhcCCCCC---CCCCcee


Q ss_pred             eCcHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHhcCCCCceeeCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHh-
Q 7108939          77 TGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGI-  155 (410)
Q Consensus        77 ~G~aGial~l~~l~~~~~~~~~~~~a~~~i~~~~~~~~~~~~~g~~~G~~Gi~~l~~~~~~~~~d~~~~~~~~~~~~~~-  155 (410)
                      +|.+||+++|.++++.+++++|.+.+.++++.+.+.++ ..++|+++|.+|++++.+.+++.+++++..+++++.+.++ 
T Consensus        75 ~G~aGia~~l~~l~~~~~~~~~~~~a~~~~~~~~~~~~-~~~~~~~~G~aGi~~~l~~l~~~~~~~~~~~~~~~~l~~~~  153 (411)
T 3e6u_A           75 TGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLT-KRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLN  153 (411)
T ss_dssp             SSHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCC-SCCCCTTTSTHHHHHHHHHHHHHTTCHHHHHHHHHHHHGGG
T ss_pred             cchHHHHHHHHHHHHhhCChHHHHHHHHHHHHHHHHhc-cCCCccCCCcHHHHHHHHHHHHHhCChHHHHHHHHHHHHHh


Q ss_pred             hcccCCCcchhccHHHHHHHHHHHHHHcCcccchHHHHHHHHHHHHHhhhhhccc----CCCCceeccCCCccccchhhH
Q 7108939         156 RLPSDLPYELLYGRAGYLWACLFLNKHIGQESISSERMRSVVEEIFRAGRQLGNK----GTCPLMYEWHGKRYWGAAHGL  231 (410)
Q Consensus       156 ~~~~~~~~Dll~G~AG~l~~ll~l~~~~~~~~~~~~~i~~~~~~Ll~~~~~~~~~----~~~pl~~~~~~~~~~G~aHG~  231 (410)
                      ..+.+.++|+++|+||++++++.+++.++++.++.+.++++++.++++++.+..+    +..|+|++|++..++|+|||.
T Consensus       154 ~~~~~~~~dll~G~aG~l~~Ll~l~~~~~~~~~~~~~i~~i~~~ii~~~~~~~~~~~~~~~~pl~~~w~~~~~~G~aHG~  233 (411)
T 3e6u_A          154 KIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGL  233 (411)
T ss_dssp             GGCTTCCSSTTTSHHHHHHHHHHHHHHHSSCCSCHHHHHHHHHHHHHHHHHHHHHTTTTTTCSCCCCBTTBCBCSTTTSH
T ss_pred             hccCCCCcchhccHHHHHHHHHHHHHhcCCcccHHHHHHHHHHHHHHhhHHHHhhcccCCCCCceeeecCccccchhccH


Q ss_pred             HHHHHHHHccc-cChHH--HHHHHHHHHHHHHHhccCCCCCCcccccCCCCccccCCcHHHHHHHHHHHHHcCcHHHHHH
Q 7108939         232 AGIMNVLMHTE-LEPDE--IKDVKGTLSYMIQNRFPSGNYLSSEGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEA  308 (410)
Q Consensus       232 aGI~~~L~~l~-~~~~~--~~~~~~~l~~~~~~~~~~g~wp~~~~~~~~~~~~WChGa~Gi~l~~~~~~~~~~d~~~~~~  308 (410)
                      +||+++|++++ ..+++  .+.++++++|+.+.++++||||+..++.++.+++||||+|||+++++.+++.+++++|++.
T Consensus       234 aGI~~~L~~~~~~~~~~~~~~~i~~~l~~~~~~~~~~gn~~~~~~~~~~~~~~WCHG~~Gi~~~l~~~~~~~~~~~~l~~  313 (411)
T 3e6u_A          234 AGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCD  313 (411)
T ss_dssp             HHHHHHHTCGGGCCCHHHHHHTHHHHHHHHHHTCCTTSCCCSBTTCCCCCCCSSSSSHHHHHHHHHHHHHHHCCHHHHHH
T ss_pred             HHHHHHHHhhHhhcCHHHHHHHHHHHHHHHHHhhccCCCCCCccCccCCccccccCCcHHHHHHHHHHHHhcCCHHHHHH


Q ss_pred             HHHHHHHHHHcCCC-CCCcccCCHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhhhhcccccCCCCCCCchhhccH
Q 7108939         309 AMEAGEVVWSRGLL-KRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGI  387 (410)
Q Consensus       309 ~~~~~~~~~~~g~~-~~~~lCHG~aG~~~~ll~~~~~t~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~gL~~G~  387 (410)
                      +.++.+.+|++|+. +++|||||.+|++++|+.+++.|++++|+++|.++++++++..+     .+.+.++.++|||+|+
T Consensus       314 a~~~~~~i~~~g~~~~~~gLCHG~aG~~~~ll~l~~~t~~~~~l~~a~~~~~~~~~~~~-----~~~~~p~~~~sL~~G~  388 (411)
T 3e6u_A          314 AYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGE-----HGCRTPDTPFSLFEGM  388 (411)
T ss_dssp             HHHHHHHHHHHCSBTTCSCSTTSHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHTTTTS-----SCCCCCSSTTSTTTSH
T ss_pred             HHHHHHHHHHcccCCCCCcccccHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhh-----ccCCCCCCCChhhccH


Q ss_pred             HHHHHHHHHHcCcccccCCCCCC
Q 7108939         388 GGMAYMLLDMNDPTQALFPGYEL  410 (410)
Q Consensus       388 aGi~~~Ll~l~~p~~~~fp~~~~  410 (410)
                      |||+|+|+|+.+|++++||+||+
T Consensus       389 aGi~~~Ll~l~~p~~~~~P~~~~  411 (411)
T 3e6u_A          389 AGTIYFLADLLVPTKARFPAFEL  411 (411)
T ss_dssp             HHHHHHHHHHTSGGGCCCTTTCC
T ss_pred             HHHHHHHHHHhCcccccCCCCCC



>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A Back     alignment and structure
>3e6u_A LANC-like protein 1; alpha barrel, cytoplasm, signaling protein; 2.60A {Homo sapiens} PDB: 3e73_A* Back     alignment and structure
>2g0d_A Nisin biosynthesis protein NISC; alpha toroid, alpha barrel, biosynthetic protein; 2.21A {Lactococcus lactis subsp} SCOP: a.102.6.1 PDB: 2g02_A Back     alignment and structure
>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A Back     alignment and structure
>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A* Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>2zzr_A Unsaturated glucuronyl hydrolase; alpha barrel; 1.75A {Streptococcus agalactiae} PDB: 3anj_A 3ank_A* 3ani_A* Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua} Back     alignment and structure
>1nc5_A Hypothetical protein YTER; structural genomics, helix barrel, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: a.102.1.6 PDB: 2d8l_A* 2gh4_A* Back     alignment and structure
>3pmm_A Putative cytoplasmic protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.90A {Klebsiella pneumoniae subsp} PDB: 3qwt_A Back     alignment and structure
>2ahf_A Unsaturated glucuronyl hydrolase; alpha6/alpha6 barrel, glycoside hydrolase family 88; 1.52A {Bacillus SP} PDB: 2ahg_A* 2fv0_A* 2fv1_A* 2d5j_A 1vd5_A 2fuz_A Back     alignment and structure
>3gt5_A N-acetylglucosamine 2-epimerase; structural genomics, isomerase, PSI-2; 1.70A {Xylella fastidiosa} Back     alignment and structure
>3k11_A Putative glycosyl hydrolase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MSE MES; 1.80A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>3k7x_A LIN0763 protein; Q92DQ0, LKR23, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.89A {Listeria innocua} Back     alignment and structure
>2zbl_A Putative isomerase; N-acyl-D-glucosamine 2-epimerase protein family; HET: BMA; 1.60A {Salmonella typhimurium} PDB: 2afa_A 2rgk_A* Back     alignment and structure
>1fp3_A N-acyl-D-glucosamine 2-epimerase; alpha/alpha-barrel, isomer; 2.00A {Sus scrofa} SCOP: a.102.1.3 Back     alignment and structure
>2gz6_A N-acetyl-D-glucosamine 2-epimerase; anabaena SP. CH1, isomer; 2.00A {Anabaena SP} Back     alignment and structure
>1gxm_A Pectate lyase; mechanism, elimination; 1.32A {Cellvibrio cellulosa} SCOP: a.102.5.1 PDB: 1gxn_A 1gxo_A* Back     alignment and structure
>1r76_A Pectate lyase; A-helical structure; 2.65A {Azospirillum irakense} SCOP: a.102.5.1 Back     alignment and structure
>1x9d_A Endoplasmic reticulum mannosyl-oligosaccharide 1, 2-alpha-mannosidase; substrate analogue, glycosyl hydrolase; HET: SMD; 1.41A {Homo sapiens} SCOP: a.102.2.1 PDB: 1fo3_A* 1fo2_A* 1fmi_A Back     alignment and structure

Homologous Structural Domains in SCOP

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 410
d2g0da1409 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {La 1e-49
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Length = 409 Back     information, alignment and structure

class: All alpha proteins
fold: alpha/alpha toroid
superfamily: LanC-like
family: LanC-like
domain: Nisin biosynthesis protein NisC
species: Lactococcus lactis [TaxId: 1358]
 Score =  190 bits (484), Expect = 1e-49
 Identities = 60/373 (16%), Positives = 109/373 (29%), Gaps = 51/373 (13%)

Query: 72  DYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVASRDSERVTFICGYAGVCAL 131
           +  L TG+ G   +L +      ++   K     +E   V+   +  +     Y+G   +
Sbjct: 30  ELTLSTGLPGIILMLAELKNKDNSKIYQKKIDNYIEYI-VSKLSTYGLLTGSLYSGAAGI 88

Query: 132 GAVAAKCLGDDQLYDRYLARFR--------------GIRLPSDLPYELLYGRAGYLWACL 177
                    DD+ Y   L                   +   +   Y+++ G +G L   L
Sbjct: 89  ALSILHLREDDEKYKNLLDSLNRYIEYFVREKIEGFNLENITPPDYDVIEGLSGILSYLL 148

Query: 178 FLNKHIGQESISSERMRSVVEEIFRAGRQLGNKGTC--------PLMYEWHGKRYWGAAH 229
            +N     +      + + +  + +    L +                   G    G AH
Sbjct: 149 LINDEQYDDLK--ILIINFLSNLTKENNGLISLYIKSENQMSQSESEMYPLGCLNMGLAH 206

Query: 230 GLAGIMNVLM----HTELEPDEIKDVKGTLSYMIQNRF--------------PSGNYLSS 271
           GLAG+  +L             +  ++  +    +                         
Sbjct: 207 GLAGVGCILAYAHIKGYSNEASLSALQKIIFIYEKFELERKKQFLWKDGLVADELKKEKV 266

Query: 272 EGSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGL-LKRVGICHG 330
               S     WC+G PG++L  +      +   FV+ A +  E    R L +    ICHG
Sbjct: 267 IREASFIRDAWCYGGPGISLLYLYGGLALDNDYFVDKAEKILESAMQRKLGIDSYMICHG 326

Query: 331 ISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGM 390
            SG   +     RL    K+    + F        E+       +G +      EGI G 
Sbjct: 327 YSGLIEICSLFKRLLNTKKFDSYMEEFNVNSEQILEE-------YGDESGTGFLEGISGC 379

Query: 391 AYMLLDMNDPTQA 403
             +L         
Sbjct: 380 ILVLSKFEYSINF 392


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target410
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lactis [Ta 100.0
d2g0da1409 Nisin biosynthesis protein NisC {Lactococcus lactis [Ta 99.71
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [Tax 97.65
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxId: 14 96.59
d1nc5a_363 Hypothetical protein YteR {Bacillus subtilis [TaxId: 14 97.6
d2d5ja1377 Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [Tax 97.15
d1nxca_467 Class I alpha-1;2-mannosidase, catalytic domain {Mouse 94.51
d2sqca1352 Squalene-hopene cyclase {Alicyclobacillus acidocaldariu 90.29
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azospirill 84.34
d1r76a_408 Polygalacturonic acid lyase (pectate lyase) {Azospirill 80.42
>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha/alpha toroid
superfamily: LanC-like
family: LanC-like
domain: Nisin biosynthesis protein NisC
species: Lactococcus lactis [TaxId: 1358]
Probab=100.00  E-value=1e-44  Score=360.75  Aligned_cols=355  Identities=17%  Similarity=0.150  Sum_probs=0.0

Q ss_pred             hHHHHHHHHHHHHHHHHhhccccCCC-CCCCCeeeCcHHHHHHHHHHHHccCCHHHHHHHHHHHHHHHHHh--cCCCCce
Q 7108939          44 SEKLHRYALSIKDKVVWETWERSGKR-VRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVAS--RDSERVT  120 (410)
Q Consensus        44 ~~~~l~~a~~i~~~l~~~~w~~~~~~-~~~~~Ly~G~aGial~l~~l~~~~~~~~~~~~a~~~i~~~~~~~--~~~~~~g  120 (410)
                      .+...+..++|......+.-.....- ..+.|||+|.+||++||+++++.|++++|.+.|++.++++.+.+  ....+.|
T Consensus         1 ~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~sLy~G~~GiaL~l~~l~~~t~~~~~~~~a~~~l~~~~~~~~~~~~~~~g   80 (409)
T d2g0da1           1 KKNIKRNVEKIIAQWDERTRKNKENFDFGELTLSTGLPGIILMLAELKNKDNSKIYQKKIDNYIEYIVSKLSTYGLLTGS   80 (409)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHC-----CGGGGSTTTSHHHHHHHHHTTTTSTTHHHHHHHHHHHHHHHHHHHHHHCCSCCC
T ss_pred             CccHHHHHHHHHHhhhhhhhcccccCCCCCCcccCCHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhcCCCCCcc


Q ss_pred             eeCCcHHH-HHHHHHHHHHhC---------CHHHHHHHHHHHHHhhcc--cCCCcchhccHHHHHHHHHHHHHHcCcccc
Q 7108939         121 FICGYAGV-CALGAVAAKCLG---------DDQLYDRYLARFRGIRLP--SDLPYELLYGRAGYLWACLFLNKHIGQESI  188 (410)
Q Consensus       121 ~~~G~~Gi-~~l~~~~~~~~~---------d~~~~~~~~~~~~~~~~~--~~~~~Dll~G~AG~l~~ll~l~~~~~~~~~  188 (410)
                      +|+|.+|+ |++ ..+.+..+         +....+.+.+.+......  +..++|+++|.||++++|+.+++...++..
T Consensus        81 lf~G~~Gi~~~l-~~~~~~~~~~~~~~~~l~~~l~~~~~~~i~~~~~~~~~~~~~D~l~G~aG~~~~LL~~~~~~~~~~~  159 (409)
T d2g0da1          81 LYSGAAGIALSI-LHLREDDEKYKNLLDSLNRYIEYFVREKIEGFNLENITPPDYDVIEGLSGILSYLLLINDEQYDDLK  159 (409)
T ss_dssp             TTTSHHHHHHHH-GGGTTTCHHHHHHHHHHHHHHHHHHHHHHHTCCGGGCCHHHHSSSSSHHHHHHHHTTCCCGGGHHHH
T ss_pred             eeCCHHHHHHHH-HHHHhcchhhhHHHHHHHHHHHHHHHHHHHHhhccccCCcccchhcccHHHHHHHHHhccccccHHH


Q ss_pred             hHHHHHHHHHHHHHhhhhhcccCCCCceec---------cCCCccccchhhHHHHHHHHHccc----cChHHHHHHHHHH
Q 7108939         189 SSERMRSVVEEIFRAGRQLGNKGTCPLMYE---------WHGKRYWGAAHGLAGIMNVLMHTE----LEPDEIKDVKGTL  255 (410)
Q Consensus       189 ~~~~i~~~~~~Ll~~~~~~~~~~~~pl~~~---------~~~~~~~G~aHG~aGI~~~L~~l~----~~~~~~~~~~~~l  255 (410)
                        ..+.+...++++....... +..+-...         +++..++|||||+|||+++|++++    ......+.+++++
T Consensus       160 --~~i~~~l~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~G~aHG~sGi~~~L~~~~~~~~~~~~~~~~~~~~~  236 (409)
T d2g0da1         160 --ILIINFLSNLTKENNGLIS-LYIKSENQMSQSESEMYPLGCLNMGLAHGLAGVGCILAYAHIKGYSNEASLSALQKII  236 (409)
T ss_dssp             --HHHHHHHHHTTSCCSSSCT-TCBCGGGSSSHHHHHHCTTCBEECCTTTSHHHHHHHHHHHHHHTCCCHHHHHHHHHHH
T ss_pred             --HHHHHHHHHHHHhcccccc-cccccccccccchhcccCCCCCccchhhhHHHHHHHHHHHHHhcCCCccHHHHHHHHH


Q ss_pred             HHHHHHhcc---CCCCCCcc-----------cccCCCCccccCCcHHHHHHHHHHHHHcCcHHHHHHHHHHHHHHHHcCC
Q 7108939         256 SYMIQNRFP---SGNYLSSE-----------GSKSDRLVHWCHGAPGVALTLVKAAQVYNTKEFVEAAMEAGEVVWSRGL  321 (410)
Q Consensus       256 ~~~~~~~~~---~g~wp~~~-----------~~~~~~~~~WChGa~Gi~l~~~~~~~~~~d~~~~~~~~~~~~~~~~~g~  321 (410)
                      +++.+.++.   ..+||+.+           .+..+.+++||||+|||+++++.++++++|+++.+.+.++++.++++++
T Consensus       237 ~~l~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~WChG~~Gi~la~~~~~~~~~d~~~~~~~~~~~~~~~~~~~  316 (409)
T d2g0da1         237 FIYEKFELERKKQFLWKDGLVADELKKEKVIREASFIRDAWCYGGPGISLLYLYGGLALDNDYFVDKAEKILESAMQRKL  316 (409)
T ss_dssp             HHHHHHCCCGGGTTCCCSEECHHHHHHTSCCSCCSCCCCCSSSSHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHCT
T ss_pred             HHHHHHhhhccccCCCCCcCcccccccccccccCcccccccCCCchHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcc


Q ss_pred             CCC-CcccCCHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhhhhcccccCCCCCCCchhhccHHHHHHHHHHHcCc
Q 7108939         322 LKR-VGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDP  400 (410)
Q Consensus       322 ~~~-~~lCHG~aG~~~~ll~~~~~t~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~gL~~G~aGi~~~Ll~l~~p  400 (410)
                      ..+ +|||||.+|++++|+.+++.++++++.+++.++.........       ..+...++|||+|.|||+|+|+++.+|
T Consensus       317 ~~~~~~LCHG~aG~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~gl~~G~aGi~~~Ll~~~~~  389 (409)
T d2g0da1         317 GIDSYMICHGYSGLIEICSLFKRLLNTKKFDSYMEEFNVNSEQILE-------EYGDESGTGFLEGISGCILVLSKFEYS  389 (409)
T ss_dssp             TCCSCCTTTSHHHHHHHHHHHHHHHCCCTTHHHHHHHHHTHHHHHH-------SCCSTTCSSTTTSHHHHHHHHHHHHSC
T ss_pred             CCCCCcccCcHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhcc-------cCCCCCCCchhccHHHHHHHHHHhcCC


Q ss_pred             cccc-----CCCCC
Q 7108939         401 TQAL-----FPGYE  409 (410)
Q Consensus       401 ~~~~-----fp~~~  409 (410)
                      .+..     |..++
T Consensus       390 ~~~~~W~~~~L~~~  403 (409)
T d2g0da1         390 INFTYWRQALLLFD  403 (409)
T ss_dssp             CCSSCGGGGGTCCT
T ss_pred             CCCCCcchhhcccc



>d2g0da1 a.102.6.1 (A:7-415) Nisin biosynthesis protein NisC {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nc5a_ a.102.1.6 (A:) Hypothetical protein YteR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2d5ja1 a.102.1.7 (A:1-377) Unsaturated glucuronyl hydrolase {Bacillus sp. GL1 [TaxId: 84635]} Back     information, alignment and structure
>d1nxca_ a.102.2.1 (A:) Class I alpha-1;2-mannosidase, catalytic domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sqca1 a.102.4.2 (A:8-36,A:308-630) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure
>d1r76a_ a.102.5.1 (A:) Polygalacturonic acid lyase (pectate lyase) {Azospirillum irakense [TaxId: 34011]} Back     information, alignment and structure