Protein Domain ID: d1auia_
Superfamily ID: d.159.1
Number of Sequences: 23
Sequence Length: 378
Structurally conserved residues: 122
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351 361 371
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
0000000000000000000000001111111111110111111111111111111111111111111129*********9**9*******8899566**********87446778999998886344347**********6422222221222111111123556899*97799864449999999965322222221111111111111111112233689853211000011111213322246776578888765689*****9**98212999*8973243588*******85532345679******999999998732112222221100000000000000000000000000000000000000000000
d1auia_: TDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPA