Protein Domain ID: d1bwda_
Superfamily ID: d.126.1
Number of Sequences: 12
Sequence Length: 348
Structurally conserved residues: 218
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
13333566667799999999988774211111222133221111001344446555467788899999999999969*****8886544422222134457**9****************98777789**********99**555******98542111111111100111112469****************9868***********99*66******86**9*8***********7*****9*89*76**9*9**9*******98653444333425789689*****959*****************99999999999998878899999999977664431111
d1bwda_: RSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKETEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIETPMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDAANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLVLTNPSRVNDENM