Protein Domain ID: d1bx4a_
Superfamily ID: c.72.1
Number of Sequences: 21
Sequence Length: 342
Structurally conserved residues: 215
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
24668*******998777776524444321111111111111111111234666777789**************50003******9985646778878887778887877766367888888876656677778888668898569995016999999*******6**887************8777********75544766778******99*********99***84336688********999982000004*******789*******9*******4*87713***8*******************9999999999999997789989997588886
d1bx4a_: VRENILFGMGNPLLDISAVVDKDFLDKYSLKPNDQILAEDKHKELFDELVKKFKVEYHAGGSTQNSIKVAQWMIQQPHKAATFFGCIGIDKFGEILKRKAAEAHVDAHYYEQNEQPTGTCAACITGDNRSLIANLAAANCYKKEKHLDLEKNWMLVEKARVCYIAGFFLTVSPESVLKVAHHASENNRIFTLNLSAPFISQFYKESLMKVMPYVDILFGNETEAATFAREQGFETKDIKEIAKKTQALPKMNS