Protein Domain ID: d1di1a_
Superfamily ID: a.128.1
Number of Sequences: 11
Sequence Length: 290
Structurally conserved residues: 213
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281
| | | | | | | | | | | | | | | | | | | | | | | | | | | | |
2222222221556888888998999899988776446668989**97****6699*6*********************99*9875555544444443133454442159****9*******88**9****************9988**9998****99999669************34****98999989******************999999759***9***8888868888*********************88511111345756668888888998888666544
d1di1a_: TPPPTQWSYLCHPRVKEVQDEVDGYFLENWKFPSFKAVRTFLDAKFSEVTCLYFPLALDDRIHFACRLLTVLFLIDDVLEHMSFADGEAYNNRLIPISRGDVLPDRTKPEEFILYDLWESMRAHDAELANEVLEPTFVFMRAQTDRARLSIHELGHYLEYREKDVGKALLSALMRFSMGLRLSADELQDMKALEANCAKQLSVVNDIYSYDKEEEALCSAVKVLAEESKLGIPATKRVLWSMTREWETVHD