Protein Domain ID: d1fg7a_
Superfamily ID: c.67.1
Number of Sequences: 63
Sequence Length: 354
Structurally conserved residues: 281
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
011111111111111222223344556678888777767888899999997899874**************946**********9******9*98657*******9****99**99899******9976766999999999999*99****9999899***8447999*9999999********9**888889*998633335******9*988897779*******99*99999*999*999989********99357789899************99****99568***99999******999999****9999*9**997667668999****99*************997
d1fg7a_: TVTITDLARENVRNLTPYQSARRLGGNGDVWLNANEYPTAVEFQLTQQTLNRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGKDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWQLDLQGISDKLDGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQASLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIA