Protein Domain ID: d1fxoa_
Superfamily ID: c.68.1
Number of Sequences: 32
Sequence Length: 292
Structurally conserved residues: 139
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
9******99555444322134599996555558**********98989*******6676999989985533345589999999899*9****999*998799**********6211777899999999*9****98777644333445543233444433235555556688******99***9998886654555778899998877989****97326799999887655555554432211000122211000000000000000000000000000000000000000
d1fxoa_: KRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACP