Protein Domain ID: d1gvfa_
Superfamily ID: c.1.10
Number of Sequences: 37
Sequence Length: 273
Structurally conserved residues: 150
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271
| | | | | | | | | | | | | | | | | | | | | | | | | | | |
001234554332234456******7*9*****9*999322348*****978777658999**9999887211157****969*9*******9*99*9****9*997555568999***9****74469*****997543577599***9***97998*****9775322111234479********99*******9887687779******999*****965665433322211110000000011122122224447999988666111000
d1gvfa_: SIISTKYLLQDAQANGYAVPAFNIHNAETIQAILEVCSEMRSPVILAGTPGTFKHIALEEIYALCSAYSTTYNMPLALHLDHHESLDDIRRKVHAGVRSAMIDGSHFPFAENVKLVKSVVDFCHSQDCSVEAELGRLGSAFLTDPQEAKRFVELTGVDSLAVAIGTAHGLYSKTPKIDFQRLAEIREVVDVPLVLHGASDVPDEFVRRTIELGVTKVNVATELKIAFAGAVKAWFAENPQGNDPRYYMRVGM