Protein Domain ID: d1i9za_
Superfamily ID: d.151.1
Number of Sequences: 9
Sequence Length: 336
Structurally conserved residues: 161
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
11111111111111111111233567************8*********632333322********81111577776765577886634443111244587****8*********5322223245*******676788********7767***********846777***8******884211235*88766***********654444442222222222255577888***544****8****8*76****87533455666311457***************8******8************86321111111111111111111111111111
d1i9za_: YDPIHEYVNHELRKRENEFSEHKNVKIFVASYNLNGCSATTKLENWLFPENTPLADIYVVGFQEIVQLTSADPAKRREWESCVKRLLNGKCTSGPGYVQLRSGQLVGTALMIFCKESCLPSIKNVEGTVKKTGLGNKGAVAIRFDYEDTGLCFITSHLAAGYTNYDERDHDYRTIASGLRFRRGRSIFNHDYVVWFGDFNYRISLTYEEVVPCIAQGKLSYLFEYDQLNKQMLTGKVFPFFSELPITFPPT