Protein Domain ID: d1l0wa3
Superfamily ID: d.104.1
Number of Sequences: 28
Sequence Length: 356
Structurally conserved residues: 102
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261 271 281 291 301 311 321 331 341 351
| | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | | |
111111110000001111123343222111212225555566666666666677778******98776665445556666665223455667777899****9899*5*****9*9988877765556679*********6999*******9****993332234443222222222222222222222100159****956555221111111125666665322111000000000223679****99**********973222222222222100122211234555544679*******99898888887333333232222222112110000000000000000000000
d1l0wa3: TPPFPVDAGWRGEEEKEASEELRLKYRYLDLRRRRMQENLRLRHRVIKAIWDFLDREGFVQVETPFLTKSTPEGARDFLVPYRHEPGLFYALPQSPQLFKQMLMVAGLDRYFQIARCFRDEDLRADRQPDFTQLDLEMSFVEVEDVLELNERLMAHVFREALGVELPLPFPRLSYEEAMERYGSDKPDLRREGFRFLWVVDFPLLEWDEEEEAWTYMHHPFTSPHPEDLPLLEKDPGRVRALAYDLVLNGV