Protein Domain ID: d1n2za_
Superfamily ID: c.92.2
Number of Sequences: 13
Sequence Length: 245
Structurally conserved residues: 179
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241
| | | | | | | | | | | | | | | | | | | | | | | | |
58*********************8*****643333366665533666676****44*********79*7969***997*9**********99************98**998*****************9*9*********943333355555668*9***999****85666656987***************9611499****96658799******8769656799*************9743
d1n2za_: AAPRVITLSPANTELAFAAGITPVGVSSYSDYPPQAQKIEQVSTWQGMNLERIVALKPDLVIAWRGGNAERQVDQLASLGIKVMWVDATSIEQIANALRQLAPWSPQPDKAEQAAQSLLDQYAQLKAQYADKPKKRVFLQFGINPPFTSGKESIQNQVLEVCGGENIFKDSRVPWPQVSREQVLARSPQAIVITGGPDQIPKIKQYWGEQLKIPVIPLTSDWFERASPRIILAAQQLCNALSQVD
d1esza_: dPNRIVAL