Protein Domain ID: d1nf2a_
Superfamily ID: c.108.1
Number of Sequences: 56
Sequence Length: 267
Structurally conserved residues: 116
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261
| | | | | | | | | | | | | | | | | | | | | | | | | | |
669************999***89********999*********999999**99999788****975655422211223344222212222222222222222222111111111111111111111111111100011100111122222221111222222222222222222211111222233368999999999988888877899999999999999999989999875666557777888833323889989988732110
d1nf2a_: MYRVFVFDLDGTLLNDNLEISEKDRRNIEKLSRKCYVVFASGRMLVSTLNVEKKYFKRTFPTIAYNGAIVYLPEEGVILNEKIPPEVAKDIIEYIKPLNVHWQAYIDDVLYSEKDNEEIKSYARHSNVDYRVEPNLSELVSKMGTTKLLLIDTPERLDELKEILSERFKDVVKVFKSFPTYLEIVPKNVDKGKALRFLRERMNWKKEEIVVFGDNENDLFMFEEAGLRVAMENAIEKVKEASDIVTLTNNDS