Protein Domain ID: d1opoa_
Superfamily ID: b.121.4
Number of Sequences: 31
Sequence Length: 267
Structurally conserved residues: 126
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251 261
| | | | | | | | | | | | | | | | | | | | | | | | | | |
5678****99**9*977745899*****966746769999*999999***96*******99997899********9758**9887789999969*****888*******988998888655577665689*******9987647988********9999999776532110000000111110000000000000000111112221000000000000000000000000000001111111110000000000000000001111
d1opoa_: SMTMSKTELLSTVKGTTGVIPSFEDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTPPTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFDKADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGKWCIIVRGTVEGGFTKPTLIGPGISGDVDYESARPIAVCELVTQMEGQILKIT