Protein Domain ID: d1r3da_
Superfamily ID: c.69.1
Number of Sequences: 82
Sequence Length: 257
Structurally conserved residues: 154
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251
| | | | | | | | | | | | | | | | | | | | | | | | | |
77888888883222699999999999999988988999998989999999999655549999999999999998569******************74799965599******9999642111222334433333332222222222333333123222222222333333223332333434434434577898887889999999999999899999888999999999899998777789999999999998753
d1r3da_: SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPAEAVEMIEQTVQAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAESSGLSYSQVAQAGHNVHHEQPQAFAKIVQAM